(data stored in SCRATCH zone)

EMBL: AM269952.PE14

AM269952.PE14        Location/Qualifiers
FT   CDS_pept        complement(24088..25107)
FT                   /locus_tag="An01g00870"
FT                   /note="Catalytic activity: COQ2 catalyzes the transfer of
FT                   the polyisoprenoid side chain to para-hydroxybenzoate
FT                   (PHB)."
FT                   /note="Pathway: COQ2 catalyzes a step in the biosynthesis
FT                   of the lipid-soluble electron carrier Coenzyme Q."
FT                   /note="Remark: The amino acid sequence of COQ2 exhibits a
FT                   typical amino-terminal mitochondrial leader sequence and
FT                   six potential membrane-spanning domains."
FT                   /note="Title: strong similarity to para-hydroxybenzoate
FT                   polyprenyltransferase Coq2 - Saccharomyces cerevisiae"
FT                   /note="See PMID 1740455"
FT                   /db_xref="GOA:A2Q7I9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I9"
FT                   /inference="profile:COGS:COG0382"
FT                   /inference="profile:PFAM:PF01040"
FT                   /inference="similar to AA sequence:PIR:S20056"
FT                   /protein_id="CAK43465.1"
FT                   /translation="METLTQRQTVHKVAITAHHEGVKAQTQPPVTNEMPIQGVAKLVPS
FT                   SWVPYVQLMRLDRPGFLGFFMPTLMGLSAGATLADPPIAPLDFFKSFLFFWFVTNFIRG
FT                   AACTWNDNLDQEFDRQVPRTRCRPIARGAVSTTQGHIFTLAQVAITAWILSHLPAQCHA
FT                   YSLAMGVLHAIYPLCKRFMDFTPVFLGLPFSVTMILPAVGMGVDPFSAPAACLFMVEFI
FT                   WTIIYETIYAHQDVQHDVQAGVKSMAVRYRHSTKIIASVLGVVMVGLMVAVGVLAGLSG
FT                   IYFLVGCGGTALSLVVMIYSVDLTKPASCLYWFRMGFYIVGGSKSAGFLAQYLVDLLG"
     atggaaaccc ttacccagcg acaaaccgtg cacaaagtgg ccataaccgc ccatcacgag        60
     ggggtcaaag cccagactca accccctgtc acaaacgaaa tgccaatcca aggcgttgcc       120
     aaattagtcc cttcatcctg ggtcccctac gtgcaactaa tgcggcttga ccggccgggc       180
     ttcctcggct tcttcatgcc aaccctgatg ggcctctccg cgggggccac tctcgccgat       240
     ccacctatcg ccccccttga tttcttcaaa tccttcctct tcttctggtt cgtcaccaac       300
     ttcatccgcg gggctgcctg cacctggaac gacaacctcg accaagagtt cgaccgccaa       360
     gtgccccgga cccgctgtcg gcccattgcc cgcggtgccg tctccaccac gcaaggccac       420
     atcttcaccc ttgctcaagt cgccatcacc gcctggatcc tgagccacct ccccgcccaa       480
     tgtcatgctt atagtctcgc catgggcgtg ctccacgcca tctaccccct ctgtaaacgc       540
     ttcatggact tcacccccgt cttcctgggt ctgcccttct ccgtgactat gatccttccc       600
     gctgtcggga tgggcgtgga ccccttctct gctcctgcgg cttgcctgtt catggttgag       660
     ttcatctgga cgatcattta tgagacgatc tacgcacacc aggacgtgca gcatgatgtc       720
     caagcgggag tgaagtccat ggcggtgcgg tatagacatt ccactaagat cattgcctcc       780
     gtgctgggtg tggtcatggt tgggctcatg gttgctgtgg gtgttcttgc tggcttgtcg       840
     ggcatttact ttctcgttgg ctgtggtggc acggcgcttt cgttggtggt tatgatttat       900
     tcggtggatt tgactaagcc tgctagttgt ctgtattggt tccgtatggg cttctatatt       960
     gtgggtggca gtaagtcggc tgggtttttg gcccagtatt tggtggatct tttgggataa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page