(data stored in SCRATCH zone)

EMBL: AM269952.PE15

AM269952.PE15        Location/Qualifiers
FT   CDS_pept        complement(join(26247..26560,26616..27055,27123..27246,
FT                   27301..27427,27486..27626))
FT                   /locus_tag="An01g00880"
FT                   /note="Catalytic activity: 6-OMT catalyzes the transfer of
FT                   the S-methyl group of S-adenosyl-L-methionine to the
FT                   6-hydroxyl group of
FT                   1,2,3,4-tetrahydro-1-[(4-hydroxyphenyl)methyl]-6,7-isoquin
FT                   olinediol (norcoclaurine)."
FT                   /note="Pathway: 6-OMT catalyzes an early step in the
FT                   biosynthetic pathway to reticuline, an important
FT                   intermediate in synthesizing isoquinoline alkaloids."
FT                   /note="Title: strong similarity to
FT                   S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase
FT                   6-OMT - Coptis japonica"
FT                   /note="See PMID 7925429"
FT                   /note="See PMID 10811648"
FT                   /db_xref="GOA:A2Q7J0"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J0"
FT                   /inference="profile:COGS:COG0500"
FT                   /inference="profile:PFAM:PF00891"
FT                   /protein_id="CAK43466.1"
FT                   /translation="MEALVEEVRRQAKSGDEKTRKDILDSLSKLYASIETPDDTVQRFT
FT                   FYNMQLACIRTAIDLKLFELLNQADGPLTVDQLSKRTGANPVFMGRLLRYLASYHAVQE
FT                   VAQDTFTASNISKTFSQRGFQAAVGHLFNNAGPSIQDLPAFLKENGYPDIQDNVKTPFQ
FT                   KVMNTELPAFLWLQQHPENLAFFNEHMKTNRFGMPTFLDVFPALEKAGGLSAERALFVD
FT                   IGGGFGQQAISFREKYSQLEGRVIVQDLAPTTANATQHPGVEFMAYDFFTPQPVKGAKF
FT                   YYLRNIFHDWPDHKCLEILQNIKDAMAPDSYILIDDMVLPNVGVHWQQAQLDMLMMAAL
FT                   GARERTQEQWNKLLQSAGLKINKVHTYTESLKDSIIEAVAA"
     atggaggccc tagtggaaga agtccgaaga caggccaagt ctggcgatga gaaaacgcgc        60
     aaggatatct tggactcact gagcaaactg tatgcttcta tcgagactcc agatgatact       120
     gttcagcgct tcaccttcta caatatgcaa ttggcttgta tccgcaccgc aatcgatcta       180
     aagctattcg agctcttaaa tcaggctgat ggccccctca ctgtggacca gctgagtaag       240
     aggacaggag ccaatccagt gtttatgggc cggttactgc gttatttggc ttcctaccac       300
     gcagtccagg aggttgccca agataccttc acggcgtcga acatctctaa aacattttcc       360
     cagcgtggat tccaagctgc tgttggccac ctctttaaca atgccgggcc gtccatccaa       420
     gatctcccag ccttcctgaa agagaacgga taccccgata ttcaggacaa tgtaaagaca       480
     cctttccaga aggtcatgaa cacggaattg ccggcgtttc tatggctgca acaacacccg       540
     gaaaatttgg cattttttaa cgaacacatg aaaaccaatc gatttggcat gcccacattt       600
     ttggacgtct tcccagccct cgaaaaggcc ggtggattaa gcgccgagcg agcccttttc       660
     gtggatattg gtggagggtt cggtcagcag gccatttcct ttcgggaaaa gtacagccaa       720
     ctcgaaggcc gagtgattgt tcaggacctg gccccgacta cggccaacgc gacgcagcat       780
     cctggcgtag agtttatggc gtacgacttt ttcactccgc agccagtcaa aggggcgaaa       840
     ttctactatt tgcggaatat cttccacgat tggccagatc acaagtgtct ggagatcttg       900
     cagaatatca aggatgctat ggccccagac tcttatattc tgattgatga catggtccta       960
     cccaatgttg gcgttcattg gcagcaggcc caattagaca tgctcatgat ggcggccttg      1020
     ggggctcggg agcgaactca ggaacagtgg aacaagctgt tacagagcgc agggctgaag      1080
     attaacaagg tacacacgta tacggagagt ttgaaggata gcattatcga agccgttgcg      1140
     gcataa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page