(data stored in SCRATCH zone)

EMBL: AM269952.PE16

AM269952.PE16        Location/Qualifiers
FT   CDS_pept        join(28653..28817,28888..29263,29329..29458,29521..29588,
FT                   29659..29993)
FT                   /locus_tag="An01g00890"
FT                   /note="Title: weak similarity to integral membrane protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /db_xref="GOA:A2Q7J1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J1"
FT                   /protein_id="CAK43467.1"
FT                   /translation="MSAPPAGGDQNRGPALVAIYWAEASFAILAVALRLYGRKLINGFG
FT                   ADDYMMVFTLILFITLAAFVTYLADQGGCRHLYYLTTDQQLLVVKFNWITQVWGIFGFA
FT                   TGKSSVALQIMRILGPNDNWMKWLLWFLMVSTTIFCGLDCLFGFVQCDPPRALWEPWIP
FT                   HTCWNTNVQANFAIFISALPTAWNVLVDLVLAALPIPIIWRTSLTLKQRIATCTLLGLG
FT                   PLAAAFGLVKIQYLAGLKERSDLTWQTYNLYVWSGSELFVIIICGCVPPMRPIFTNLFG
FT                   RKSQFTGYYESSSGYKRRHNYKLSTLGSSQPVQSQDEDTEALHSRVEGTGSHLPQSRFS
FT                   ENAIYREVNISIENGPK"
     atgagcgcac caccggctgg cggtgatcag aatcgcggcc ctgctctggt ggccatttat        60
     tgggccgagg catctttcgc cattttggcg gtcgccctgc gactctatgg ccggaaactg       120
     atcaatggct ttggcgctga tgactatatg atggtcttta ccctgatcct attcatcact       180
     ctggctgctt tcgtgaccta ccttgccgac caaggaggtt gccgacatct ctactatttg       240
     acaaccgatc aacaactctt agtcgtgaag ttcaactgga tcactcaagt atggggtatc       300
     tttggcttcg cgactggcaa gagctcggtg gccctacaga ttatgcggat tctgggcccg       360
     aatgataact ggatgaaatg gctcttatgg ttcctaatgg tctctaccac catcttctgc       420
     ggcttggact gcctcttcgg cttcgtgcag tgtgatcctc cccgcgcact atgggagcct       480
     tggattcccc atacctgctg gaacacgaat gtacaggcga actttgcgat tttcatatca       540
     gcgctgccta cagcatggaa tgtgctggta gaccttgtcc tcgctgctct ccccatcccg       600
     attatctggc ggacgagtct taccctcaag cagcggattg ccacctgtac ccttcttggg       660
     cttggaccat tagctgcagc ctttggcctt gtcaaaatcc aatacctcgc tggattgaaa       720
     gagcgttctg acctgacctg gcaaacttac aacctgtatg tctggtccgg atccgaactc       780
     ttcgtgatca tcatctgcgg ctgcgtgccg ccgatgcgtc ctatattcac gaacctgttc       840
     ggacgcaaga gccagtttac aggctactac gagtcctctt ctggatataa gcgtcgacat       900
     aattacaaac tcagcactct gggatcatcg cagccggtcc agagtcagga tgaggatacc       960
     gaagcgctgc attctcgggt ggaggggact ggatcacatc tgcctcagtc gcgttttagt      1020
     gagaatgcga tttatcggga ggttaatata tcgatagaga atggtcctaa gtga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page