(data stored in SCRATCH zone)

EMBL: AM269952.PE17

AM269952.PE17        Location/Qualifiers
FT   CDS_pept        complement(join(30933..31465,31832..31991,32096..32361,
FT                   32482..32678,32737..32757,32806..33507,33561..34251,
FT                   34314..34557))
FT                   /locus_tag="An01g00900"
FT                   /note="Catalytic activity: Protein tyrosine phosphate +
FT                   H(2)O = protein tyrosine + phosphate."
FT                   /note="Function: pyp2+ encodes a nonreceptor type protein
FT                   tyrosine phosphatase that negatively regulates mitosis."
FT                   /note="Title: similarity to protein-tyrosine-phosphatase
FT                   pyp2p - Schizosaccharomyces pombe"
FT                   /note="See PMID 1448087"
FT                   /note="See PMID 1464319"
FT                   /db_xref="GOA:A2Q7J2"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J2"
FT                   /inference="profile:COGS:COG5599"
FT                   /inference="profile:PFAM:PF00102"
FT                   /inference="similar to AA sequence:PIR:T45160"
FT                   /protein_id="CAK43468.1"
FT                   /translation="MAIASRAAECAQLFDKYARTLDGDELLKQDMENEIFRFNLWAANN
FT                   FILTPGRASMDWRLRNAPLLQSTMAELLDDLKADLINQSNFPFNSTIPTGMLYELPLHA
FT                   VSETLDGLFRLSRAIRRSGILRRYVKVGNYVEFDENGVNLTEAFRNGVKTLIEFRMKES
FT                   KSSNGLRERIINTVCLRQQYFSYLKAKKATNAPISGADQSHQSTPRSALRATASVTGSL
FT                   TSKAQGAARQQSSPMRRPGPSIMTATTAQPDRIPKAYSVKSAHEQQTYDVDCNDADIPP
FT                   PPNVSGNRKESECPYCFLACSKEELSGRRWKHHIIQDLMPYICVLEPCPTPNSLFESGK
FT                   DWLSHMKNQHPVSGWTCVDSTHDTTFFFQSESGFREHLHQYHEDQFDDDDIDDIATACY
FT                   QKLPDDIIIRECPFCPTVQKLELKPKDMINHVANHLISLAQISLAGHIDDGRSQSAWSG
FT                   SSRDSSSLPASIGSLPERLHSEFRDDDETEYLASISGEVIPDADEELIYALWQKVQKPQ
FT                   DDPSLDLTLRHFIAQSGMQAKVTTEGAVVGSNDLDTGQSSEKEQATAPELDRSSEDSAG
FT                   VLQDTAREGSLKIVEMFDEEGNPRLFDEITDDVPPFLCQSDSEIYDKFEELEWEERVRL
FT                   NEGMLTNDPAHPYALEQDPEVSARNRYDNVQAWANSRIHLRVPEGECDFINASPIILRD
FT                   SVTQEERTYIATQAPIIGYLSHFWHMVFHESKDVAVIVMLTQTFEAGREKCAQYFPLHL
FT                   DQASMFLESTFDVKSRSEIRKLELTIGSETKIVWHFLFAGWPEYSKPEGDDCEALLELI
FT                   RLSASKSGPQNPRVVHCSSGVGRTGTFIALEHLLQELESGQLLQLADPEADPVFDTVNQ
FT                   MREQRMMMVYNVKQFQFIYDVLREQTDIKLGKVRPRNNGSLGSQMEEPRPAKLAKIGDQ
FT                   ANKVPAS"
     atggcaattg catccagggc tgccgaatgc gcccaattat tcgacaagta tgcgaggaca        60
     ctggacgggg acgagctgct caagcaggac atggaaaacg aaatcttccg gttcaacctg       120
     tgggcagcaa ataatttcat actgacccca ggtcgagctt cgatggactg gagattgcgg       180
     aatgccccat tactgcaatc gacgatggcc gagttgctgg atgacttgaa agctgacctt       240
     atcaaccagt ctaattttcc attcaattcc accattccta ctggaatgct atatgaactt       300
     ccccttcatg ctgtcagtga gacgctggat ggccttttcc gcttgtctcg cgccatccgt       360
     cgctcgggaa ttctccgcag atacgtcaaa gttgggaact atgttgagtt tgatgagaat       420
     ggcgtaaatc tgacagaagc gtttagaaac ggtgtaaaga cgctcataga gttccgcatg       480
     aaggaatcca agtcgagcaa tggcctgcgt gaacgcatta tcaataccgt ctgtttacgc       540
     cagcaatatt tttcttacct gaaagccaag aaggccacaa acgctccaat atcaggggct       600
     gaccagagcc atcaatccac tccaaggtca gcactcaggg ccacagccag cgttacgggt       660
     tcccttacgt cgaaggcaca aggagctgcg agacagcaat catcacctat gcgaaggcct       720
     ggcccgtcta tcatgacagc gacaacagct caacccgatc gaattcctaa ggcttactct       780
     gtaaagtcgg cccatgaaca gcagacctat gatgtggatt gtaatgatgc ggatatccct       840
     ccaccaccaa acgtgtctgg caaccgcaag gagtcagagt gtccatactg ctttctggct       900
     tgttctaaag aagagctgag cggaagaagg tggaagcacc acattattca ggacctcatg       960
     ccatatattt gtgtcctgga gccttgtcct accccaaatt ctctttttga gtcgggcaag      1020
     gactggttga gtcacatgaa gaaccagcac cctgtcagtg gttggacctg tgtcgatagc      1080
     acacacgata cgacattctt ctttcagtca gagtctggct tcagggagca tttgcatcaa      1140
     taccatgaag accaattcga cgacgacgat atcgatgata tcgcgaccgc atgctatcaa      1200
     aaactacccg acgatatcat catacgggaa tgccctttct gtcctacagt gcagaaacta      1260
     gaactaaagc cgaaggatat gataaatcat gtcgcaaacc accttatttc gctggcacaa      1320
     atctctcttg caggacatat agatgacggg cggtcgcaat cagcatggtc cggatcaagc      1380
     agggactcaa gttcgcttcc agccagtatc ggatctcttc cggaacgatt acactcggaa      1440
     tttagagatg acgatgagac tgaatatctc gcctccatat caggtgaggt gattccagat      1500
     gcagatgagg agctgattta tgccttgtgg cagaaagtcc aaaaaccaca ggacgatcca      1560
     tcactggatt tgacacttcg ccacttcatc gctcaatctg gaatgcaagc gaaggtgacc      1620
     acagaaggcg ccgttgtggg tagtaatgac ttagatacgg ggcagagctc cgagaaggaa      1680
     caggctacgg cacccgagct ggacaggagc agcgaagaca gcgcgggtgt actacaagac      1740
     acagctagag aaggcagtct aaagattgtt gagatgtttg acgaggaggg aaacccaagg      1800
     ttgtttgatg agattacgga tgatgtcccg ccgtttctgt gccaatcaga ctcagagatt      1860
     tacgacaagt ttgaggaact cgaatgggag gaaagggtgc gtctgaatga aggcatgctg      1920
     accaacgatc ctgcccatcc ctacgccctt gaacaagatc ccgaagtcag cgcccgcaat      1980
     cgatatgaca atgtacaggc atgggccaac tcccgcattc atctgcgggt gcccgagggc      2040
     gaatgtgatt ttatcaacgc ctcaccgatc atactgaggg actcggtcac gcaagaggag      2100
     aggacataca ttgcgacgca ggcccctata attggctatc tctcgcactt ttggcatatg      2160
     gttttccatg aaagcaaaga tgtggctgtc attgtcatgt tgacgcagac cttcgaggct      2220
     ggacgggaaa aatgtgcaca gtactttcct ctgcacctgg accaggcttc gatgttcctg      2280
     gagtcaacgt ttgatgtcaa gtctcgctcg gagattcgca agctcgagtt aactatcggc      2340
     tcagagacga aaatcgtgtg gcattttctc tttgcaggct ggccagaata ttccaagccc      2400
     gaaggcgacg attgcgaggc gctccttgaa ttgatcagat tatcagcttc caaatcgggg      2460
     cctcagaatc cacgtgtggt ccactgcagc tcaggagtcg gccgcacggg aactttcatc      2520
     gcccttgagc atctcctcca agagcttgaa tcgggccagt tgctgcagct agccgatccc      2580
     gaagccgacc ctgtctttga cacggttaac cagatgcgcg agcaacgcat gatgatggtt      2640
     tacaacgtga agcaatttca gttcatctat gacgtgctcc gagagcaaac ggatatcaaa      2700
     ctgggtaagg ttcggccacg aaacaatgga tcacttggga gccagatgga ggaaccacga      2760
     ccagccaagc tcgccaaaat aggcgatcag gccaataaag tgcccgcatc gtga            2814
//

If you have problems or comments...

PBIL Back to PBIL home page