(data stored in SCRATCH zone)

EMBL: AM269952.PE18

AM269952.PE18        Location/Qualifiers
FT   CDS_pept        join(34893..35728,35780..37813,37896..37959,38230..38295)
FT                   /locus_tag="An01g00910"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAD21096.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q7J3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J3"
FT                   /inference="profile:COGS:COG0775"
FT                   /inference="similar to AA sequence:UniProtKB:NCB8L21.11"
FT                   /protein_id="CAK43469.1"
FT                   /translation="MAHRSADIDLVCLVSDVITALGGTFRHSPRLYRDLKVSLAIMALE
FT                   IHNVDISVALSEEPNLRRTFENMAEALDRAFRKDFVNTKYQQLKAGEETQPPRLSKWWP
FT                   RLFTSWTDSPKVYMKNWTQTSYPYLGLVSELLQSSLQRELRIGELIIDDYRVIRDLTNL
FT                   ANKLVEQLDRGQSFDDDEDFTEKAQPNPSISEAAIRGETSIHYLSQNLYHTLHENWPCQ
FT                   LEGHEHGRKLGHCVEAKFCLDPQWSSRDPDPSRDSFFILLAGSDIIQECRVRWLPTDVM
FT                   IETNTLACLVDHEASKDVCLQLAKDDNNRLWGLELGQPLEVLQLAEECTGRSLESLRKL
FT                   LEIVKPTYAAKRVLGLTLARSLLHLLEGPWVSSYLSIDDIFIFCKVQNGYPYPLFDKVF
FT                   LSTAFKTIDSECGPQASRRPPYSIHPFPTILALGIALAEMELGDELHDIYGQPSFAGLR
FT                   NKPSRLAKKLWEECERRFHLGTGLMRTVRFCTDQTSFLRFADMGKETVFTDSEFVDVYC
FT                   KNAIRPLEEDLVNGAKWTWDEVNRLQRRDLVDQGVCKIIKLKIDPPSNEISERMRNTEP
FT                   KWSKPPGHVSSLVTIPEANGSVEYSQQNLSSDETLRINDKASHCQPSDTQEPVRPKTRD
FT                   GFDVAIICALPIEADAVLSAFDHHWDKELYGKATNDPNFYSVGVMRGRNVVLVHPPRSG
FT                   KAPAANVATACAMSFTKVTLALIVGVCGGVPFKHNKEEILLGDVVISKGVIQYDHGRQY
FT                   SDGFKRKIEMEAALGRPNPQIGSVLAALETQFHRENAQHKITAFLDNLDDDVTSYPGHV
FT                   EDRLFPSWYRHKHHNHQVCRVCADCWNNDDSVCDIAPELNCQATGCEDIRIVKRHRQNQ
FT                   RNQPFVHVGLIASGDSVLKSATHRDQIAENENVIAFEMEGAGAWDALPCVVIKGVCDYA
FT                   DSHKNKLWQKYAAITAAACAREFIQHCSLGITKMALITKYKRPIETRELDLYFRCVPRL
FT                   TEIKPSNNKT"
     atggctcatc gctcagcaga catcgacctg gtctgtttag tctcagatgt cattacagcg        60
     ttagggggga ccttcagaca ctccccccga ttgtaccgcg acctgaaggt atcactggct       120
     ataatggctc tggagataca caatgtagat atttctgtgg ccctctccga agagccaaac       180
     ttacggcgga cattcgagaa catggcggaa gcgttggaca gggctttccg caaggacttc       240
     gtgaacacaa agtatcagca gttaaaggca ggagaagaaa cgcaacctcc taggctctcc       300
     aagtggtggc ctcggttgtt caccagttgg accgacagcc cgaaagtgta tatgaagaat       360
     tggacacaaa cttcttaccc atatcttgga ctggtgtctg agcttcttca aagttcttta       420
     caacgagagc tacggatagg agagctcata attgatgatt atcgagttat tcgagatctg       480
     accaacttgg ccaataagct ggtagaacaa ctcgatcgcg gtcaatcttt tgatgatgac       540
     gaagacttca ctgaaaaggc acagccgaac ccgtcgatca gcgaggcggc cattcgtggt       600
     gagaccagca ttcactatct gtcgcagaat ctctaccaca cactgcacga gaattggcct       660
     tgtcaattgg aagggcatga gcatggcaga aaactaggcc attgtgtgga agcaaaattc       720
     tgccttgacc cccagtggag ctctcgagat ccggatccgt cgcgcgatag ctttttcatc       780
     ctgttggcgg gttcagatat cattcaggag tgccgggttc gttggcttcc taccgatgtt       840
     atgattgaaa cgaacaccct tgcgtgcctt gtagatcacg aagcctcgaa agacgtctgc       900
     ttacaactgg cgaaggacga caataaccga ctttggggtc tggaattagg gcagccactt       960
     gaggtcctac agctggcgga agagtgtact ggaagatctc ttgaaagcct tcgaaagttg      1020
     ctggagattg tgaagcccac atatgcagca aagcgagttc tggggctgac attagcgcgg      1080
     tctcttctgc accttctgga agggccatgg gtcagttcgt atctatccat cgatgatatc      1140
     ttcatcttct gcaaagtaca gaatggctac ccatacccat tgtttgacaa agtattcctc      1200
     tcgacggctt ttaagacaat tgatagcgaa tgcggtcccc aggctagccg acggcctcct      1260
     tacagtattc acccgtttcc gacaatcctt gccctcggaa tcgcgctagc cgaaatggag      1320
     ctaggagacg agcttcatga catctacggt cagccatctt tcgctggact gaggaacaag      1380
     ccatctaggc ttgcaaaaaa gctgtgggaa gagtgtgagc gtcggttcca tttggggact      1440
     ggtttaatgc ggaccgtcag gttttgtacg gatcaaacgt cattccttcg cttcgccgac      1500
     atgggcaaag aaactgtttt cacggattcg gaatttgtgg atgtctattg caagaatgct      1560
     atcagaccgt tagaagaaga ccttgtgaat ggggcaaagt ggacgtggga tgaagtaaat      1620
     aggctccagc gccgcgacct tgtcgatcag ggagtctgca aaatcatcaa gttgaaaatt      1680
     gacccccctt caaatgaaat cagtgaacga atgcggaata cagaaccaaa gtggagcaaa      1740
     ccaccaggac atgtgtcaag cttagtcaca ataccagagg ccaatggttc cgtggaatat      1800
     tcccagcaga atctctctag cgacgaaacc ctgcgtatca atgacaaggc aagtcattgt      1860
     caaccatccg acacgcaaga gcctgtgaga ccgaagacta gagatggctt cgacgtagcc      1920
     atcatttgtg cactccctat agaagccgat gcagttttgt ctgctttcga ccatcattgg      1980
     gacaaagaat tgtacggcaa ggcaacgaat gatcccaact tttactctgt gggcgttatg      2040
     cgtggtcgaa atgttgtttt ggttcatcct ccacgctctg gcaaagcacc tgccgccaac      2100
     gtcgctaccg cgtgtgccat gagttttacc aaggtgacgc tggctctcat tgttggggtg      2160
     tgcgggggcg ttccattcaa acacaacaag gaggagatcc tacttggtga tgttgtgatt      2220
     agcaaaggag tcatacaata tgatcatgga cgacagtact cggacggatt taaacggaag      2280
     attgaaatgg aagcagcatt aggtagaccg aacccacaaa ttggctcggt tttggcggca      2340
     ctagaaactc agtttcaccg agagaacgcc cagcataaga taaccgcctt cctcgacaac      2400
     ttggacgacg atgtgacatc ctatcctgga catgtggaag ataggttgtt cccatcatgg      2460
     tatcgtcata aacaccacaa tcaccaggta tgtcgagtgt gtgcagattg ctggaataat      2520
     gacgactccg tctgcgacat tgccccggaa ttgaactgtc aagcgaccgg ctgcgaggat      2580
     atacgcatcg taaaacgaca taggcaaaat caaaggaacc aaccgtttgt tcatgtcggt      2640
     ctcatagcat ctggagatag cgttctcaag tccgctacac atcgggacca gattgcagag      2700
     aacgagaatg tcattgcatt tgagatggaa ggagcaggtg cttgggatgc cctaccttgt      2760
     gttgttatta agggagtctg tgactacgct gatagtcata agaataaatt atggcagaaa      2820
     tatgcagcaa ttactgcggc ggcttgtgct agggaattca tccagcactg ttcactcgga      2880
     atcaccaaaa tggcactgat cacaaaatat aagcggccca tagaaacgcg cgagttagat      2940
     ctgtatttca gatgtgttcc gaggttgact gaaatcaagc ctagcaataa taagacctag      3000
//

If you have problems or comments...

PBIL Back to PBIL home page