(data stored in SCRATCH zone)

EMBL: AM269952.PE2

AM269952.PE2         Location/Qualifiers
FT   CDS_pept        join(3206..3432,3501..3519)
FT                   /locus_tag="An01g00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7H7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H7"
FT                   /protein_id="CAK43453.1"
FT                   /translation="MTIPYPLIGPESYGLGSKQARRNRSTCSTPRSVDSIVVDAAFAKE
FT                   IQSTNASQEHLDSCASSNKSEKKWKARFSRKFFHFP"
     atgactatcc cttatccctt gatcggccct gagtcctacg gccttggctc caagcaggcg        60
     cgccgcaacc gcagcacttg cagcacccct cgcagcgttg acagcatcgt cgtcgatgcc       120
     gctttcgcca aggaaatcca gtccaccaac gcctcccagg agcatttgga ttcttgtgct       180
     agcagcaaca agtctgagaa gaagtggaag gctcgattct cgaggaagtt cttccacttc       240
     ccttga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page