(data stored in SCRATCH zone)

EMBL: AM269952.PE20

AM269952.PE20        Location/Qualifiers
FT   CDS_pept        join(41231..41713,41848..42207)
FT                   /locus_tag="An01g00930"
FT                   /note="Catalytic activity: Methyl chloride transferase
FT                   catalyzes the synthesis of methyl chloride from
FT                   S-adenosine-L-methionine and chloride ion."
FT                   /note="Title: similarity to methyl chloride transferase
FT                   AAC72357.1 - Batis maritima"
FT                   /note="See PMID 9789006"
FT                   /db_xref="GOA:A2Q7J5"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J5"
FT                   /inference="profile:COGS:COG0500"
FT                   /inference="similar to AA sequence:UniProtKB:AF084829.1"
FT                   /protein_id="CAK43471.1"
FT                   /translation="MTTPTDNKFKDAQAYLAKHQGDSYLKGWDLLWDKGDYLPWDRGFP
FT                   NPALEDTLVERAGTIGGPIGPDGKRRKVLVPGCGRGVDVLLFASFGYDAYGLECSAAAV
FT                   EACKKEEEKVNNIQYRVRDEKVGKGKITFVQGDFFDDAWLKEIGVPRNGFDVIYDYTFF
FT                   CALNPELRPKWALRHTELLAPFPAGNLICLESPRHRDPLAPGPPFASPSEAYMEHLSHP
FT                   GEEISYNDKGLVDADPLREPSKAGLERVAYWQPERTHTVGKDKNGVIQDRVSIWRRRD"
     atgacgactc ctaccgacaa taagttcaag gatgctcaag catatttggc caaacatcaa        60
     ggggacagtt atcttaaggg ctgggacctc ctctgggaca aaggtgatta tctgccctgg       120
     gatcgaggct tccccaaccc cgcgctagaa gacaccctgg tcgagcgagc tggcaccatt       180
     ggtgggccca tcggcccgga tggtaagagg cggaaggtcc tagtcccggg ctgtggacgt       240
     ggagtcgacg tgctcttatt cgcgagcttt gggtatgacg cctatggcct ggagtgcagc       300
     gccgcggctg tcgaagcgtg caagaaggag gaggagaagg tgaacaatat ccagtaccgc       360
     gtgcgagatg agaaagttgg caaagggaag attactttcg tccaggggga tttctttgat       420
     gacgcctggt tgaaggaaat tggagtacct cgaaatggtt ttgatgttat ttatgattac       480
     acgtttttct gtgctctgaa cccagagctc cgtcctaaat gggctctgcg acacaccgag       540
     ctccttgctc ccttccctgc aggcaatctg atctgtctgg agtctcctcg tcatagggac       600
     cccctggccc ccggccctcc atttgcctct ccctccgagg cctatatgga gcatctgagc       660
     caccccggtg aggagatctc ctacaacgat aagggtcttg ttgacgcgga cccgttgcga       720
     gagcccagca aggcgggcct ggagagagtg gcgtactggc agccagagcg cacacacact       780
     gtgggcaagg ataagaatgg ggtgatccaa gacagagtct ctatttggcg tcgacgtgac       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page