(data stored in SCRATCH zone)

EMBL: AM269952.PE22

AM269952.PE22        Location/Qualifiers
FT   CDS_pept        join(44185..44281,44335..44630,44763..44782,44830..44968,
FT                   45164..45172,45222..45304,45342..45369,45636..45684,
FT                   45956..46084,46247..46620)
FT                   /locus_tag="An01g00950"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An11g07790 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7J7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J7"
FT                   /protein_id="CAK43473.1"
FT                   /translation="MSSFTQPVPVVACGRIPTMGKSISQHLLPEYQVIHFILSYEAAEA
FT                   ELPHLLAGRDPQSRSPNEIGTHDYSQPPRAVIFGRGYEPQQVEELKKKFAGVPKEPVAW
FT                   VRGNPADLPAGAAGPEYAQNVAADMKKGRYQGYLTFRTIRTRVNLPRPRTRSLFRQIGK
FT                   TLELYTPPRKMDRKLYKGCLLEIVLVRLSELGTLNSIQSMFTLIHQSHGNESDTVSSSS
FT                   QNVANVAISYGQNEWLEIPLGEGETNRVGDHTTQLDAEAEAEMTAKMQHRKIQNRKNQR
FT                   ARRQRGSIRRRNRHVQLPCTVSRSRLTPLTITVSDPKPTWALPRCEGDDEGEVTAGHKG
FT                   LIVWGEPYDMQNWEATPGFLAKWSWAVDGCHDLVECSNRWRRMRGEEPIRLAESLEGSR
FT                   PWRCRLAT"
     atgtcttcat tcactcagcc agtgccagta gttgcctgcg gcagaatacc cacgatgggg        60
     aaatcaatct cccagcacct actgccggaa taccaagtca tccacttcat cctgtcatat       120
     gaggctgcag aggctgagct cccgcatctg cttgcaggtc gcgatcctca gtctcggagt       180
     cccaatgaaa tcggaaccca cgattacagc cagcctcctc gcgcggtaat cttcggtcgc       240
     ggctatgagc ctcagcaggt tgaagaactt aagaagaaat tcgcgggtgt tcccaaagaa       300
     cctgttgctt gggtgagggg gaacccagcg gacttgcctg ccggggccgc tgggcctgag       360
     tatgctcaga atgtcgcggc ggatatgaag aagggccgat atcaaggata tttaacattt       420
     agaacaatta gaacgcgggt taatttaccg cggccacgga cccgctctct ctttcggcaa       480
     ataggaaaga ccctggaatt atatactcca cctcgcaaga tggatcgaaa attatataaa       540
     ggctgtcttt tggaaattgt actggtgcgc ctttccgaac ttggcacact taatagcatc       600
     caatccatgt ttactttaat tcaccaatca catggaaatg agagtgatac tgttagttct       660
     tcgagccaga atgttgccaa tgttgcaatc agctacgggc agaatgagtg gctcgagata       720
     cccctaggcg agggcgaaac aaacagagtc ggtgatcaca ccactcaact cgatgccgag       780
     gctgaggccg agatgacggc caagatgcag cacaggaaga ttcaaaaccg gaagaaccaa       840
     agagcacgcc gacaacgcgg tagcatccga aggcgcaacc gtcatgtaca gctcccctgc       900
     acggtctcac gttcacgact cacgcccctc acgatcactg tctccgatcc taaacctacg       960
     tgggccctgc cccgctgcga gggggatgat gagggtgagg taactgcggg gcacaaggga      1020
     ctcattgttt ggggcgagcc atacgacatg cagaactggg aggccacccc cggcttcctt      1080
     gccaagtggt cgtgggccgt ggatggatgc cacgatctgg ttgaatgtag taaccgctgg      1140
     aggcggatga gaggagagga gcctattcgt ctcgctgaat cattggaagg aagcaggcca      1200
     tggagatgca ggcttgccac ttaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page