(data stored in SCRATCH zone)

EMBL: AM269952.PE23

AM269952.PE23        Location/Qualifiers
FT   CDS_pept        complement(47046..48044)
FT                   /locus_tag="An01g00960"
FT                   /note="Title: strong similarity to hypothetical
FT                   oxidoreductase DR2595 - Deinococcus radiodurans"
FT                   /db_xref="GOA:A2Q7J8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J8"
FT                   /inference="profile:COGS:COG1028"
FT                   /inference="profile:PFAM:PF00106"
FT                   /inference="similar to AA sequence:PIR:H75255"
FT                   /protein_id="CAK43474.1"
FT                   /translation="MSRYAEAHAKPNGPGDARPTALEIIKDEGVEGKLKGEVIVITGTS
FT                   SGIGIETTRALATTGATLFLTARDVTKAQSALAGIFEPSRMKIIEMDQASLSSVRIAAA
FT                   AILAETSKIHLLVNNAGIMAIPDLRLTADGHELQFCTNYLSHFLFYKLLEPALLAAASA
FT                   DLPSRVVNLASSAHNVHGINDTDNYNFQKGGYDPSVAYGQSKTANIYMANEIERRYGSR
FT                   HLHSTSVHPGLVQTGLAQHMPPDAFKGMGHLYPIMKSVEQGAATSVWGAVGKAWKHEGG
FT                   KYLVDCAVAEPYAEGDDKFTAPGYSPYAYDVEKAKRLWIDSLELVGLRDEE"
     atgtcacgtt acgctgaagc ccacgccaag ccgaacggcc ctggcgatgc tcgcccgacg        60
     gccctggaaa tcatcaagga cgagggcgtt gaaggcaagc tcaagggcga ggtcatcgtc       120
     atcaccggta cgtcttctgg catcggcatc gaaaccactc gcgccctggc caccacgggt       180
     gccactctct ttctcacggc ccgagacgtc accaaggccc aatccgccct cgctggtatc       240
     tttgaacctt cccgcatgaa gattattgag atggaccagg cctctctctc ttcggttcgc       300
     atcgcagctg cagccattct cgccgaaacc tccaagattc accttctcgt gaacaacgcc       360
     ggcatcatgg ccattcccga cctgcgccta accgctgatg gccacgaact ccaattctgc       420
     accaactacc tttcgcattt cctgttctac aagctcttgg agcccgctct cctggctgcc       480
     gcctccgccg acctcccgtc ccgagtcgtc aatctcgctt cctcagccca caacgtccac       540
     gggatcaatg acaccgacaa ctacaacttc cagaaaggcg gctacgaccc cagtgtggcc       600
     tacggacaat ccaagacggc caacatttac atggcgaacg aaatcgagcg ccgctatggc       660
     tcgcgccacc tacactccac gagcgtccat cccggccttg tgcagaccgg gctggcccaa       720
     catatgcccc cggatgcctt caagggaatg gggcacttgt accccatcat gaagagcgtt       780
     gagcagggtg cggcaacatc ggtctgggga gccgttggca aggcttggaa acatgagggc       840
     ggcaagtacc ttgttgactg tgccgtagca gagccgtatg cggaaggaga cgacaagttc       900
     actgcgcctg gatattcccc atacgcctat gacgtcgaga aggcgaagag gctttggatc       960
     gactcgctcg aacttgtagg gttgcgggat gaggagtag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page