(data stored in SCRATCH zone)

EMBL: AM269952.PE24

AM269952.PE24        Location/Qualifiers
FT   CDS_pept        join(48793..49191,49249..49292,49769..49911,50154..50467)
FT                   /locus_tag="An01g00970"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An11g04000 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7J9"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J9"
FT                   /protein_id="CAK43475.1"
FT                   /translation="MSSSMNLRQCIEATARAFLSAYEEGSVQNDASIINRNVTADCRRY
FT                   LLPSSVPHAFGLPADFFFDTAKYQEMFGKDIKVLKFTNNIMANLIIDTEARRAAFTSVA
FT                   EVHANNGETYPAEMAWFLYFNEDGSKVKKFGSEAYRMWRDIQTSLIERPTLAILRTIIP
FT                   MAVGPHRDPPIFHFRPEREILTFSTSIQPPVLSMVRCPICQEHVALSDINGHLDSGCQT
FT                   FIATQLQSPASSTLNETDCEQRESRAIAQGTTEQHHLKNNYNSTVPLDVDRNKKRSFNR
FT                   NPTPRARNQIRDYHRLSL"
     atgtcctcct cgatgaactt aagacagtgc atagaggcta cagcacgagc cttcctatcc        60
     gcgtacgaag agggctcggt ccagaacgac gcctccatca tcaaccgcaa cgtcacagcg       120
     gactgcagac ggtacctgct tccctcgtcc gtaccccatg cctttggcct accggcggac       180
     ttctttttcg acacggcaaa gtatcaggag atgtttggga aggacatcaa ggtgttgaaa       240
     ttcacaaaca acatcatggc gaacctgatc atcgataccg aagcccgccg ggccgctttt       300
     acgtctgtcg cagaggtgca cgccaataac ggagaaacgt acccggcaga gatggcttgg       360
     ttcttgtact ttaatgagga tgggtctaaa gtcaagaagt tcggctctga agcatacaga       420
     atgtggaggg atatccagac gagcttaata gaacgaccca ctttggctat actccgtaca       480
     atcataccca tggctgttgg cccacatcgg gatccgccca ttttccattt tagaccagaa       540
     cgcgagattt taactttctc tacttccatc cagcctcctg tgctctccat ggtcagatgt       600
     cccatatgcc aggaacatgt tgctctgtcc gacatcaacg gacacctcga ctctggctgc       660
     cagacattca tcgcaaccca gctacagagt ccagcatctt ctactttaaa cgaaactgac       720
     tgcgagcaac gtgagagtcg tgccattgct caaggaacaa cggaacaaca tcacctgaag       780
     aataactata attcaacagt cccgctcgat gtggacagaa ataaaaagag gtcctttaat       840
     aggaacccaa caccgcgcgc aagaaaccag atacgggatt accatcgact aagcttataa       900
//

If you have problems or comments...

PBIL Back to PBIL home page