(data stored in SCRATCH zone)

EMBL: AM269952.PE25

AM269952.PE25        Location/Qualifiers
FT   CDS_pept        complement(52389..52661)
FT                   /locus_tag="An01g00990"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An01g12970 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7K0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K0"
FT                   /protein_id="CAK43476.1"
FT                   /translation="MSRVIPKRDKKRPQDRNAQRATRQRTKDCLALLELQVSQLQGGAD
FT                   KALSDELRQMRKERDELGTLADDLVTIAEATKSALESSNNEAAQT"
     atgtcgcgag ttatcccaaa acgcgataag aagagacctc aggatcgaaa tgcgcaacgc        60
     gctactcgcc aacgcaccaa ggactgcctg gcactgctgg agctccaagt ctcgcagctg       120
     caaggcggcg cagacaaggc gctttcagat gagctcaggc agatgcgcaa agagcgcgac       180
     gaattgggca cactagctga tgatctagtt actatcgcag aagcaacaaa atcagcattg       240
     gagtccagca ataatgaagc cgcccagaca tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page