(data stored in SCRATCH zone)

EMBL: AM269952.PE26

AM269952.PE26        Location/Qualifiers
FT   CDS_pept        complement(join(52846..53695,53731..53909,53966..54169))
FT                   /locus_tag="An01g01000"
FT                   /note="Title: similarity to hypothetical protein BAC11036.1
FT                   - Homo sapiens"
FT                   /db_xref="GOA:A2Q7K1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K1"
FT                   /inference="similar to AA sequence:UniProtKB:AK074519.1"
FT                   /protein_id="CAK43477.1"
FT                   /translation="MAAMMTPGSPVRLGPGPRRRSSNLVILLLVIIALLWSLVIHQNIG
FT                   RGLHVTLDDIRDPLDAIVNNTLGFEKIFAISPAQRLDRRDAIVLASSATGFHVDFIDGL
FT                   ILDEDSAKVRQPGTHDEYLAHDLCSCFPPACECCAEVASRVTYCSFTSSNKIYRIVADG
FT                   IASALILEDDVDWDINLKMQLKGLALGSQQIPKINAPERNATTDSPYGDSWDVLWIGHC
FT                   GMKCNSSSPVQVMPHDITAMPSRYLPPYLYDAPAGTGNNVRMSCIIEKAACSAAYAITY
FT                   GASQKILAALTRLTDDDNLDFPNLLSELCHNGSLECYSSYPSLVGRWKRGRREEYSSDN
FT                   DQEAVDRQMSHSSGVMYSTLGNIEHILGGECTVRASIDDAIVPELNPDLFEVPHSFLQW
FT                   TDKKGGHERAL"
     atggctgcta tgatgactcc cgggtctccg gtcaggttgg gccctggacc gcgccgtcga        60
     tcttcaaatc tggtcatctt actgctcgtc atcatagctt tactttggtc tttagttatt       120
     catcaaaata ttgggcgcgg cctacatgtt acgctcgacg acatccggga ccccttagac       180
     gcgatcgtaa acaacacatt aggttttgag aagatatttg cgattagccc agcacagcgt       240
     ttagacagac gcgatgcgat tgtacttgca tcctcagcta caggatttca tgtcgacttc       300
     attgacgggt taatccttga cgaagacagc gccaaggtcc gtcaacctgg aacccacgat       360
     gaatatttag ctcacgattt gtgttcctgt ttcccgcccg catgcgaatg ctgtgcagag       420
     gtagcgtctc gtgtcacata ctgttcgttc acatcatcta ataaaatcta tagaattgtc       480
     gcagatggga tcgcaagtgc attaatactt gaggacgacg ttgactggga tataaatctc       540
     aagatgcaat tgaagggact cgccctaggc tctcagcaaa taccgaagat caacgccccg       600
     gaaaggaatg cgaccacaga ttctccatac ggagacagct gggacgttct ttggattggt       660
     cactgtggta tgaagtgcaa cagctcttca cctgttcagg tgatgcctca cgacataaca       720
     gcaatgcctt ctcgctacct tccgccttat ttatatgacg ccccagccgg aactgggaac       780
     aatgtccgca tgagctgcat aatagagaag gcggcatgta gtgcagcgta cgcgattacc       840
     tacggcgcgt cccagaagat cctcgctgct ttgacacggc tcacagacga tgacaatctg       900
     gattttccaa acctccttag tgaactctgt cacaatggct cattggagtg ctactcgtct       960
     tacccgtcgc tagttggaag atggaaacgc ggcagaagag aagaatattc ctccgataac      1020
     gaccaagaag ccgttgatcg tcagatgtct cattcttctg gggtgatgta cagcaccctg      1080
     gggaatatcg agcatatctt gggcggggag tgtaccgtgc gagcctccat cgatgatgcc      1140
     atagttccag agcttaaccc ggacctcttc gaggtacctc attcgtttct ccagtggaca      1200
     gataagaaag gaggacatga gagagcgtta taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page