(data stored in SCRATCH zone)

EMBL: AM269952.PE27

AM269952.PE27        Location/Qualifiers
FT   CDS_pept        complement(54791..56044)
FT                   /locus_tag="An01g01010"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   Y49E10.24 - Caenorhabditis elegans"
FT                   /db_xref="GOA:A2Q7K2"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K2"
FT                   /inference="similar to AA sequence:PIR:T27047"
FT                   /protein_id="CAK43478.1"
FT                   /translation="MPITVSLVNQQQCYAGNDRIRGRVIFQCPTPTEIQDIRVTFSGRA
FT                   KAKVQKTKGSAAPAASYRSKCILFEKERILWHPNGDTVAPDTYEWPFEFVFPSHAQAAS
FT                   SRWPETLPFRSDANHPLPPTFAAETHDSLRKLECTIEYRVHAQVFRPQRGILGRKSPLF
FT                   SEVVHLNFLPLEARWDLKSTDSYPATYQQQKEQLFNIRSMLLLPENKGRSLKVQEKIQS
FT                   WLSPGQLPRFSFKASFSYPTRMIQSAPIPCFLDITPFMEDSSVISPPDIVMQSLSIFMV
FT                   SQTAARAAPSLMGALSGQVDERIEILSRTSLGMRVLGKVDLAQAFGHLRIRHTDVSFRT
FT                   FNISRTYRLCASFSFECAGKTSTFDVPDLPVELLANSWEPEKATQSFEGHVAEDASPPP
FT                   YASASTLSTSSITTPEKS"
     atgcctatca ccgtgtcgtt ggtcaatcag cagcagtgtt acgctggaaa tgaccgaatc        60
     agaggtcgtg ttatctttca atgtcctacc ccaacagaga ttcaggatat tcgagtgaca       120
     ttctccgggc gcgcaaaggc aaaggtgcag aagaccaagg gatctgcagc ccctgccgcc       180
     agctatcgta gcaaatgtat ccttttcgaa aaggagagaa tactatggca cccgaatggc       240
     gatacagttg cccctgacac gtatgaatgg ccgttcgaat tcgtctttcc gtcacatgcc       300
     caggccgcct cgtcaagatg gcccgaaact ttgcctttcc gcagcgacgc gaatcacccc       360
     ctgccaccca cctttgcagc cgaaactcat gattctttac ggaagctgga gtgcaccatc       420
     gagtaccgag tccacgccca agtattcaga ccgcagcgag gaatcttagg gagaaagtca       480
     cctttgttct ctgaggtcgt acatttgaac tttttaccgc ttgaagctag atgggatttg       540
     aaaagcacag acagctaccc tgcgacatat cagcaacaga aggagcagtt gttcaatata       600
     cgaagcatgc ttctactccc ggaaaataag ggaagaagcc tgaaggtgca ggagaagatc       660
     cagtcatggc tatcacctgg tcagctgcct cggttcagct ttaaagcgtc tttttcctac       720
     cccacacgca tgatacaatc tgcaccgatc ccatgctttt tagacattac gccttttatg       780
     gaggactctt ctgttatttc acctccggac attgtgatgc aatctttgtc catcttcatg       840
     gtcagtcaaa ctgccgctcg ggccgctccg tctttaatgg gagcattatc gggccaagtt       900
     gacgagcgga ttgaaatact atcacggacg tcactcggta tgcgagtttt gggtaaagtg       960
     gacttagcgc aggcttttgg acatcttaga atcaggcata cagatgtttc tttccgcaca      1020
     ttcaacatca gcaggacgta tcggttgtgc gcgtcatttt cgtttgaatg tgcaggaaaa      1080
     acaagtacct ttgatgttcc cgatctccct gtggagctat tggcaaactc ttgggaacca      1140
     gaaaaagcta ctcaaagctt cgaagggcac gttgcggagg acgctagccc gccgccatat      1200
     gcatctgcgt caactttgtc tacatcatca ataacgacgc ccgagaaatc ctga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page