(data stored in SCRATCH zone)

EMBL: AM269952.PE28

AM269952.PE28        Location/Qualifiers
FT   CDS_pept        join(57788..57947,58003..61121)
FT                   /locus_tag="An01g01020"
FT                   /note="Title: similarity to protein SEQ ID NO:628 from
FT                   patent WO200222660-A2 - Homo sapiens"
FT                   /db_xref="GOA:A2Q7K3"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR012317"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K3"
FT                   /protein_id="CAK43479.1"
FT                   /translation="MPWKLFRKDLSDVCLRGRFPRLSHLRLGDEDSTIAFTYSFQPSMH
FT                   IEFMVSILDATEYPDNHSYFAFAVTDNIPPAVSAILETVQCKFNGCSLETFLEGFCNYL
FT                   DQAALGREPRASSPIDDDFDAISDGEDMDWDEYPDAPQMDHSVDMKQLRTDLRAAKSAG
FT                   FKVGYLGDLEGSFIVSISCRIASLGISQDAMQMWDVCPTHFIVLLLYYPRGYRRLDHIV
FT                   SQSQTAPSPVRMYVGFCDRYKPTAVSIPETHQEFSGLGVSSSTPKSALKSSFITDPLET
FT                   LLNDRFLSIVQDRLRHGFSWTGAEIFYNDAQGKKLDTKDSKLPKYFVPEEWAKFTPGFV
FT                   KADDLSQHTAHQLSLPLIAMQYTLRRFVKCTEFCLNCHCKIDAGFEALKPYVCSSPLCL
FT                   YQYMQLGMGPKLEWEIVTQPYVVDMLVSFAYARAAQGQLTDLPSGLGMKVASTGSTLPS
FT                   WTARLDAAKMTLLAQKPHNLKVGEWILIKLANASDLPSTVSSLCSTVLQVHDQSLVEIS
FT                   QPISVGYWADPQDSLSDGLDVQVVPFRVDFDSLAGDLKQKAVMLLLDTLPDVFSMKYFI
FT                   ESSAPEHKALASWHGTICPSALYVLRWILASNRSCIVHDDNPEHQVTGMHNYMQFRLAQ
FT                   GSPDKEARFVQELNNSSNTEFPTLFAWHGSPIYNWHSILREGLNFAQQLNGRAYGDGVY
FT                   MAKDLEVSRIYCSRGSMSGAKWSRSKLDITSAISLNEVVNSPTKFKLTKPYYVVTQLDW
FT                   IQSRYLFISGGGIKAQGENKNKPSKVYKQHPDWTARGPGNEPVSIPISALGTRQSQSHK
FT                   NKDDSNGLATGHRQKKRKASTKGVCGPSESSSTTDPNDDTEIEDLRLLDSDSDGDVIGK
FT                   SRRVDASKSSHNLTRGSKTDFQPGTLQAHSFKLLGPPSYATTTATKSLQRHLKATLRIQ
FT                   DREPLHEIGWYVDPTLINNVYQWIVEFHSFDPSLPLAQDLKQKGLTSVVMEMRFPPQFP
FT                   MSPPFIRVVRPRFMSFQQRGGGHVTAGGAMCMELLTSSGWLPTSSIDSVFLQVRMALCS
FT                   TEPWPARIERDGDYPFSEAVSAYRRACQAHGWKVPDDFNRIEAA"
     atgccttgga aactcttccg caaagatctt tccgacgtat gcctccgagg gagatttccc        60
     cgtctaagcc acctcaggct cggtgacgaa gacagtacca tcgcctttac ctacagcttc       120
     cagcccagca tgcacattga atttatggtc tccattcttg atgccaccga ataccccgat       180
     aatcacagtt actttgcgtt cgctgtcacg gacaatatcc ccccggctgt ttccgccatt       240
     ctggagacag tacaatgcaa gttcaatggt tgctctctag agacattcct agaaggcttc       300
     tgtaattacc ttgaccaagc tgccctcggg agagaaccgc gggcaagttc tcctatagat       360
     gacgacttcg atgccatctc agatggtgaa gatatggact gggacgagta ccccgatgcc       420
     ccacagatgg accattccgt ggatatgaag caactgcgga ctgatcttcg agcagctaaa       480
     agcgcaggat tcaaggttgg ctatcttggt gacctggagg gctcgttcat tgtgtctatt       540
     tcctgccgca ttgctagcct aggcatttca caggatgcca tgcaaatgtg ggatgtctgc       600
     cccacacact ttatagtgtt gcttctttat tacccaaggg ggtatcggag actagaccac       660
     attgtatccc agtcccagac agctccttcg ccagtcagga tgtatgtcgg tttttgcgat       720
     aggtacaagc ccacggcggt gtctatccca gagacgcacc aggaattctc cggcctcggt       780
     gtatcaagct caactcccaa atcggcttta aaatcttcgt tcatcaccga cccgttagag       840
     acccttctca acgatcgctt cctcagtatt gtacaagatc gactcagaca cggtttctca       900
     tggaccgggg cagaaatttt ctacaatgac gctcagggta agaagctaga taccaaagat       960
     tctaagcttc ccaaatactt tgttccagaa gaatgggcca agttcacacc cggcttcgtt      1020
     aaagcagacg atctgtcaca gcatacagca catcagctgt cccttcctct cattgccatg      1080
     cagtatactc tgcgacgttt tgttaagtgc acggaattct gtctgaactg tcattgcaag      1140
     atagacgccg gttttgaggc tctaaagcct tatgtttgtt ccagtccgtt atgcctctat      1200
     caatatatgc aacttgggat gggtcccaag ctagaatggg agatagtcac acagccgtat      1260
     gtggtagaca tgctcgttag ctttgcttat gctcgggctg cacaagggca actgactgac      1320
     cttccctctg gactcggcat gaaggttgcc tctactggat caactctgcc atcatggact      1380
     gcgaggctgg atgctgccaa gatgacacta ttagcccaaa agcctcataa tctcaaagtt      1440
     ggtgaatgga ttctaataaa gctagccaat gcgtctgatc taccatcgac tgtttcatcg      1500
     ctctgcagta ctgtgctcca agtgcatgac cagtcacttg tcgagatctc gcagcctatc      1560
     tctgtaggct attgggctga cccacaagac tcgctttctg acgggctaga cgtgcaagtt      1620
     gtacccttcc gtgttgactt tgatagttta gctggagatt tgaaacagaa agcagtcatg      1680
     ctactccttg acacattacc cgatgtcttt tcgatgaaat atttcatcga gagcagtgcg      1740
     cctgagcaca aagcgctcgc ctcgtggcat ggcacaatct gcccatcagc tctatatgta      1800
     ctacgatgga ttcttgcttc aaacagatcg tgcatcgtac acgacgataa tcctgaacat      1860
     caggtgacag gaatgcacaa ctacatgcaa ttcaggctag cgcaggggtc tccagacaaa      1920
     gaagctcggt tcgtccagga actcaataac agctcaaata cggagttccc cacgcttttc      1980
     gcttggcacg gaagcccaat ttataattgg cacagcatac tgagagaagg tttaaacttt      2040
     gctcaacagc tgaatggccg tgcttatgga gatggtgttt atatggcgaa agatcttgag      2100
     gtttctcgca tatactgctc tcgtggtagt atgtctggag ccaagtggtc acgaagcaag      2160
     ttagacatca cttctgctat ctcgctgaat gaagttgtca attcaccgac aaaattcaaa      2220
     ctgaccaagc cctattacgt tgttactcaa ctagactgga ttcagtcgcg gtacctgttt      2280
     atctcagggg gtggtatcaa agctcaagga gaaaacaaga acaaaccctc aaaggtttac      2340
     aaacagcatc cggattggac ggcacgtggc cctggtaatg agcctgtttc cattcctata      2400
     tcggcccttg gcactcggca gagccagagc cacaagaaca aagatgattc gaatgggcta      2460
     gccacaggtc atagacaaaa gaaaaggaag gcatctacga agggggtatg tggtccgtct      2520
     gagagctcat cgaccactga tcctaacgac gatacggaga ttgaggatct tcgcttactt      2580
     gattcggact cggatggcga tgtcattgga aaatcaagac gtgtcgatgc atcaaagtcc      2640
     agtcataatc tgacacgcgg gtccaaaacc gacttccagc ccggcacatt gcaagctcat      2700
     tctttcaagc tccttggacc accaagctac gcgaccacaa ccgcgacaaa gtcactacag      2760
     cgtcatctca aggcaacatt acgcatccag gaccgagagc ctctacatga gatcggttgg      2820
     tatgtcgacc ccacacttat caacaacgtt tatcagtgga tcgtcgagtt ccacagcttc      2880
     gatccctctc ttcctttggc acaggatctc aagcagaaag gtctcacgag cgttgttatg      2940
     gaaatgcgct ttccgccgca gtttccgatg tctccgcctt ttatccgcgt tgttcgaccc      3000
     cgatttatgt ccttccaaca acgcggtggt ggccatgtga ccgctggtgg cgccatgtgc      3060
     atggagctac tcacaagctc aggctggctt ccgacgagct ccatagacag tgtgtttcta      3120
     caggtacgta tggcactctg ctcaacagag ccttggcctg cacggattga acgcgatggc      3180
     gattacccgt tcagtgaagc tgtgagtgcc tacaggcgag cttgtcaagc acatggttgg      3240
     aaggtgcctg atgattttaa tcgcatcgag gcggcatga                             3279
//

If you have problems or comments...

PBIL Back to PBIL home page