(data stored in SCRATCH zone)

EMBL: AM269952.PE29

AM269952.PE29        Location/Qualifiers
FT   CDS_pept        complement(61565..62047)
FT                   /locus_tag="An01g01030"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An16g05360 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7K4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K4"
FT                   /protein_id="CAK43480.1"
FT                   /translation="MTHYPVYIIRTHLAMPGPDLPSPRYHTAIFVETDPVTGSGTIHEV
FT                   TGDITSPEGMYYESKLAPQPESVENFFSRTLLGMTDAAHYPNSWDNVLREIPAPPQQKA
FT                   FNVKRMKTEPFKRLSPLEFYEAGEERRPLVKCTEWVVDKAIPALRKAGLLQSSISA"
     atgactcact accctgtcta cataatccga acccatttgg caatgccagg ccccgacctt        60
     ccttctccgc gctatcacac tgcgatcttc gttgaaacag acccagtgac tggctctgga       120
     accatccacg aagtgaccgg ggatatcacc tcaccagagg ggatgtacta cgaatctaaa       180
     ctcgcccctc aaccagagtc cgtcgagaac ttcttttctc gaacactgct tggtatgacg       240
     gatgcagcac actatcccaa ctcttgggac aacgttctac gagagattcc agctccccca       300
     caacaaaagg cattcaacgt taaacgaatg aagactgagc ctttcaagag gctgtcgcct       360
     ctagagttct atgaggccgg tgaggaaaga cgaccgttgg tgaagtgcac tgagtgggtg       420
     gttgacaagg cgattccggc gctgaggaag gctggccttt tgcaatcatc aatttctgca       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page