(data stored in SCRATCH zone)

EMBL: AM269952.PE3

AM269952.PE3         Location/Qualifiers
FT   CDS_pept        complement(5146..5361)
FT                   /locus_tag="An01g00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7H8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H8"
FT                   /protein_id="CAK43454.1"
FT                   /translation="MSDRTGSTNNNNNNNKKSGGSGGAQITEAQASFITTPRNINQLNT
FT                   WGQSARNRRQGNKEESDSKGPSDSSR"
     atgtctgaca gaaccggctc caccaacaac aacaataaca acaacaagaa atctggaggt        60
     agtggtggtg ctcagatcac tgaagcgcaa gctagcttca tcaccacccc aaggaacatt       120
     aaccagctga atacctgggg ccaatctgcc aggaacagac gtcagggaaa caaagaagaa       180
     tccgacagca agggaccatc tgactcttcc agatag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page