(data stored in SCRATCH zone)

EMBL: AM269952.PE30

AM269952.PE30        Location/Qualifiers
FT   CDS_pept        62600..64339
FT                   /locus_tag="An01g01040"
FT                   /note="Function: Ank3 plays an important role in the
FT                   polarized distribution of many integral membrane proteins."
FT                   /note="Function: the ankyrin domain is supposed to mediate
FT                   protein-protein interactions."
FT                   /note="Localization: Ank3 is a broadly distributed
FT                   epithelial ankyrin and is the major ankyrin in the kidney
FT                   and other tissues."
FT                   /note="Remark: Ank3 is expressed in alternatively spliced
FT                   forms including forms that lack the NH2-terminal repeat
FT                   domain."
FT                   /note="Title: similarity to ankyrin 3 Ank3 - Mus musculus"
FT                   /note="See PMID 7615634"
FT                   /note="See PMID 9060470"
FT                   /db_xref="GOA:A2Q7K5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K5"
FT                   /inference="profile:COGS:COG0666"
FT                   /inference="profile:PFAM:PF00023"
FT                   /protein_id="CAK43481.1"
FT                   /translation="MSSDMDTQVSSGTEMGVSLPFLQAARQLNYDRLSLLIAEGHHPNR
FT                   RDENGYTALHRAILECPEDLTTVAMLLTYGANPHAVFKDRNSLREITPLHYAAIRGDVG
FT                   LVSLFLHHGKSDPAPRSLKYWTTPLEDAISNGHLTVVARFIEFFSSSQLLNKPSRGIDE
FT                   SIILSARLWYSKALSLLLEYKKHHLFPSPHGPDVLKHAFCEAIRSEACNSSVQGIGERA
FT                   GGPGDNTPSKCANLLLQAGVRFRDDEMDRLLSITCSNAHLIGVTRLLLNLGPKVTAHHI
FT                   TRAIESQSYHMVKIVTKYVITSAGEDAIKRDSEPDLIQYAASHGSLDTFEYLATELGTA
FT                   SSQSQPIATTESRKTPLIHYAVWGLRIDVVQHLLSTQGANVNEQDEYGHSPLMYAFDIA
FT                   QASDENPCLAIIQLLMQYGVDVKASSIEGLTALHLAVRLGITPAVQLLLSNGCDPNAKT
FT                   TTGSDLYLRRSPSSWSPETTARNRTPLHWAVDRLANVSYDVVRLLLHYGADMNAEDGNG
FT                   VTPLNLLLGEGWCINRAWESRMAVVNLFLTFGANIDIKDMSGITARQRIRQREAELCAP
FT                   VVD"
     atgtcgagcg atatggacac ccaggtctcg agcggaacgg agatgggagt ctcattaccg        60
     ttcctgcaag cagcacgcca gctgaattac gaccgtttga gtttgttgat cgctgaaggt       120
     catcatccca acagacgcga tgaaaatggc tatacggctt tgcatcgggc tatacttgaa       180
     tgccctgaag acctaactac tgttgccatg ctgctgacgt acggagcaaa cccacatgct       240
     gttttcaagg atcggaacag cttacgcgaa ataacaccct tacattatgc tgccataagg       300
     ggagatgttg ggctggtgtc cctctttctc catcatggaa aaagtgaccc ggcccctcga       360
     agcctcaaat attggaccac ccccctcgag gatgccatca gcaatggtca tctcacggtg       420
     gtggcaagat ttattgagtt cttctcgagc agtcagctgc tgaacaagcc gtcccgcgga       480
     atagatgaat ctatcatatt gtccgcgaga ctctggtact cgaaggcatt gtcgctgcta       540
     cttgagtaca agaagcacca cttattcccc agtcctcatg ggcccgacgt tctcaagcat       600
     gccttttgcg aagctatccg atctgaagct tgcaactcca gcgtccaggg cattggtgag       660
     cgagctggag gtcccggaga taatactcct tctaaatgcg caaacctcct tcttcaagcc       720
     ggagtacgct tcagggacga tgaaatggat cgacttctca gcataacctg cagcaacgcc       780
     catctgatcg gtgttacccg cctgcttttg aacctgggcc ccaaggtgac cgcccatcac       840
     attacccgcg ccatagagag ccagagttat cacatggtga aaatcgttac caaatatgtc       900
     atcaccagtg ccggagaaga cgcaatcaaa cgcgacagtg agcctgacct catccagtac       960
     gctgcaagtc acggcagcct cgacaccttc gaatacctgg ccacggagct cggtacagct      1020
     tcatctcaga gccaacctat cgccacgacc gagagccgca aaactcctct tatccattac      1080
     gctgtgtggg gcctccgcat cgacgttgtc cagcatcttc tctccacgca aggcgcaaac      1140
     gtcaacgagc aagacgaata tggccactca ccactgatgt atgctttcga catcgcacaa      1200
     gcaagcgacg agaacccgtg cctggctata attcagctcc tgatgcagta cggtgtcgat      1260
     gtgaaagcca gttcgatcga gggtctcact gctctgcatc tcgccgtcag actaggaatc      1320
     accccggctg tccagctcct cctctcgaat gggtgtgatc ccaatgctaa aacaaccacc      1380
     ggcagcgatc tgtatctcag acggagcccc agctcttgga gcccagagac taccgcacgc      1440
     aaccgaaccc cattgcattg ggctgttgat cggttggcga atgtttccta tgatgttgtt      1500
     agacttttgc tccattacgg tgctgatatg aatgctgagg acggaaatgg tgtcacgcct      1560
     ttgaaccttc tactcggcga gggatggtgc attaatagag cttgggagtc tcgtatggcg      1620
     gttgttaacc tcttcctgac ctttggtgca aacattgaca tcaaagatat gagcggaatc      1680
     acggcacgtc agaggatccg tcagcgagag gcggagttgt gtgcccctgt tgttgactag      1740
//

If you have problems or comments...

PBIL Back to PBIL home page