(data stored in SCRATCH zone)

EMBL: AM269952.PE31

AM269952.PE31        Location/Qualifiers
FT   CDS_pept        complement(join(65596..65889,65954..66558,66618..66750))
FT                   /locus_tag="An01g01050"
FT                   /note="Title: similarity to hypothetical protein YLR007w
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q7K6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K6"
FT                   /inference="similar to AA sequence:PIR:S64829"
FT                   /protein_id="CAK43482.1"
FT                   /translation="MPRYAEDHDRYDDSNRAFLQAFMARSTMTFTQAKPVLAAIFSIRD
FT                   DEQVSPEDITEDDLQTYIAAANSAISPFDLEIRSILPQIEINNNNDPPPAPERVYALVN
FT                   TTSDALTQLATTYSADEIAFVKRILDAMFDTYNTRRQEAMVISSMQALQLAKAGAGDAN
FT                   RRESGTQQQATQGGAAQSLTMTQAETMLKQLVEQGWFEKSRKGYYRLSPRGLMELRGWL
FT                   VAAYNDEGIRKIKFCAACRDIITAGQRCGDRDCTGRLHDHCMRNFFRMQQAESCPVCKS
FT                   AWPGDRFVGERAITMSDPAAQRARRSAANTQQAEAGPSTQFTLPELDVEDEADGGEEEA
FT                   GSD"
     atgccccgat acgcagaaga ccacgaccgc tacgatgaca gcaaccgcgc atttctccaa        60
     gccttcatgg cgcggtccac catgaccttt acacaagcaa agcccgttct ggctgctata       120
     ttctccatca gagacgacga acaagtttcc ccagaagaca taacggaaga cgacctccaa       180
     acctacatcg ccgccgccaa cagcgccata tcccccttcg acctcgaaat ccggagcata       240
     ctaccccaga ttgaaatcaa caacaacaat gaccctcccc cagctccgga acgagtctac       300
     gccctcgtca acacaaccag cgacgccctc acccagctcg caacaacata ctccgccgac       360
     gaaatcgcct tcgtgaagcg catcctcgac gccatgttcg acacatacaa tacccgccgc       420
     caggaagcaa tggtcataag tagtatgcag gcattgcagc tggccaaggc tggtgcaggg       480
     gacgcaaata gacgggagtc aggaacacag cagcaagcga cgcagggagg cgcggcacag       540
     tcgttgacta tgacgcaggc ggagacgatg ctgaagcagc ttgtcgagca ggggtggttt       600
     gagaagagca ggaaggggta ttatcggttg agtccgcgcg ggttgatgga gttgaggggg       660
     tggttggtgg cggcgtataa tgatgagggg attaggaaga ttaagttctg tgctgcgtgt       720
     agggatatca ttactgctgg ccaacgatgc ggagaccgcg attgtaccgg acgattgcac       780
     gatcactgca tgcggaattt ctttcgtatg caacaggctg aaagctgtcc tgtgtgcaag       840
     agtgcgtggc cgggtgatcg attcgttggt gagcgcgcga ttactatgtc tgatccggct       900
     gcacagaggg ctagacggtc ggctgcgaat actcagcagg ccgaagctgg gcctagtacg       960
     cagttcacgt tgccggaact ggatgttgaa gatgaagcgg atggtggtga ggaagaggct      1020
     gggagtgatt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page