(data stored in SCRATCH zone)

EMBL: AM269952.PE32

AM269952.PE32        Location/Qualifiers
FT   CDS_pept        complement(join(67275..67603,67683..67983))
FT                   /locus_tag="An01g01060"
FT                   /note="Complex: Forms a heterodimer with the spU2AF59 large
FT                   subunit."
FT                   /note="Function: spU2AF23 is the SNRNP auxiliary factor
FT                   small subunit which is necessary for the splicing of
FT                   pre-mRNA."
FT                   /note="Localization: Nuclear protein."
FT                   /note="Remark: Binds to the polypyrimidine tract of introns
FT                   early during spliceosome assembly."
FT                   /note="Title: strong similarity to splicing factor spU2AF23
FT                   - Schizosaccharomyces pombe"
FT                   /note="See PMID 8657565"
FT                   /db_xref="GOA:A2Q7K7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K7"
FT                   /inference="profile:PFAM:PF00642"
FT                   /inference="similar to AA sequence:PIR:T39243"
FT                   /protein_id="CAK43483.1"
FT                   /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQT
FT                   ILMPNMYQNPAYDPKSKMNPSQLQNHFDAFYEDVWCEMCKYGELEELVVCDNNNDHLIG
FT                   NVYARFKYEEDAQAACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGGFCN
FT                   FIHRKDPSNELDRDLRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
     atggccaact atctcgcctc catcttcggt acagagcagg acaaggtcaa ctgctccttc        60
     tactacaaaa tcggagcttg cagacatggc gaccgctgct ctcgaaagca cgttaagccg       120
     tcatactctc agacgatcct gatgccgaac atgtaccaga atcccgcgta cgacccgaag       180
     agcaagatga accccagtca gctacagaac cactttgatg ctttctacga ggatgtgtgg       240
     tgcgagatgt gcaagtacgg cgagttggag gaattggttg tctgcgataa caacaatgac       300
     cacctcattg gaaacgtcta cgcgcgcttc aaatacgaag aagatgccca ggccgcctgc       360
     gacgctttga attcacggtg gtacgcggca cgacctatat attgtgaatt atcaccggtt       420
     acagattttc gagaagcttg ttgtcggtta aatagcggcg aggggtgtgt acgtggtgga       480
     ttctgcaact tcattcatcg gaaggacccc agcaatgaat tggatcggga tcttcgtctc       540
     agtacgaaga agtggctgaa ggagcgtggc agggatgcga gaagtgtcag ccgcagtcct       600
     agtccggagc cgacccggag gaggtactag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page