(data stored in SCRATCH zone)

EMBL: AM269952.PE34

AM269952.PE34        Location/Qualifiers
FT   CDS_pept        join(71306..71342,71423..71736,71827..72197,72255..72291)
FT                   /locus_tag="An01g01080"
FT                   /note="Catalytic activity: 7,8-dihydrobiopterin + NADP(+) =
FT                   sepiapterin + NADPH."
FT                   /note="Pathway: Sepiapterin reductase SPR
FT                   (7,8-dihydrobiopterin: NADP+ oxidoreductase) catalyzes the
FT                   terminal step in the biosynthetic pathway for
FT                   tetrahydrobiopterin, the cofactor necessary for aromatic
FT                   amino acid hydroxylation."
FT                   /note="Title: strong similarity to sepiapterin reductase
FT                   SPR - Rattus norvegicus"
FT                   /note="See PMID 2201030"
FT                   /note="See PMID 2260974"
FT                   /db_xref="GOA:A2Q7K9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K9"
FT                   /inference="profile:COGS:COG1028"
FT                   /inference="profile:PFAM:PF00106"
FT                   /protein_id="CAK43485.1"
FT                   /translation="MSKTIIVTGASRGIGLAITKYLLTAPQSHNVVVIARSREPLEKLK
FT                   EQYSKQVEVLNGDLADFSIGQKAVDLALRSFGRLDGMVLNHGMLGQVGKVKDADFEQWK
FT                   HGFDVNFISLVAFIKAGLPALRESKGKIIFTSSGAAVSAYRGWALYGATKAAMNHLALS
FT                   LGEEEPEVTTISIRPGMVDTEMQRELREDHATTLEPQMHAKFTTVHKEGKLLKPEQPGH
FT                   VMAKLVLDAPNELTGKFFTWNDKALEAFQA"
     atgtccaaga ccatcatcgt taccggtgcc tcgagaggaa tcggcctcgc catcacgaaa        60
     tacctcctca cggcacccca atcccacaat gttgtcgtga tcgcccgcag ccgtgaacct       120
     ctcgagaagc ttaaggagca atacagcaag caagtcgagg tgctcaatgg cgacctggct       180
     gacttctcca tcggtcagaa ggccgtggac ctggctctca ggtccttcgg tcgtctggac       240
     ggcatggtcc tcaaccacgg catgcttgga caagtaggca aggtcaagga cgcggatttc       300
     gagcagtgga agcacggatt cgacgtgaac tttatcagtc ttgttgcttt tatcaaggcc       360
     ggtcttcccg ccctccgtga atccaaggga aaaatcatct tcacttcgtc gggtgctgcc       420
     gtctctgcct acaggggctg ggctctctac ggtgcgacga aggcggccat gaaccatctc       480
     gccttgagct tgggagagga agaacccgag gttactacaa tttcgatcag gcctggcatg       540
     gttgacaccg agatgcagcg ggagctacgc gaggaccatg ctacgacctt ggagccgcag       600
     atgcatgcca agtttacgac ggtccacaag gagggcaagc tcctcaagcc agagcagccg       660
     ggtcatgtta tggccaagct ggttttggac gctcctaacg agcttactgg gaagttcttc       720
     acgtggaacg acaaggctct ggaggcattc caggcgtag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page