(data stored in SCRATCH zone)

EMBL: AM269952.PE35

AM269952.PE35        Location/Qualifiers
FT   CDS_pept        join(73098..73119,73188..73214,73367..73626,73692..73811)
FT                   /locus_tag="An01g01090"
FT                   /note="Complex: Dr1 directly interacts with the
FT                   TATA-binding protein (TBP) subunit of the multiprotein
FT                   TFIID complex."
FT                   /note="Function: Dr1 has a regulatory role in repression of
FT                   class II gene transcription that is mediated via
FT                   phosphorylation."
FT                   /note="Title: similarity to TATA-binding protein-associated
FT                   phosphoprotein Dr1 - Homo sapiens"
FT                   /note="See PMID 7958881"
FT                   /note="See PMID 1339312"
FT                   /db_xref="GOA:A2Q7L0"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR042225"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L0"
FT                   /inference="profile:COGS:COG5150"
FT                   /inference="profile:PFAM:PF00808"
FT                   /inference="similar to AA sequence:PIR:A43320"
FT                   /protein_id="CAK43486.1"
FT                   /translation="MSDREFSANDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLME
FT                   CCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFSDYIPDVLAVAEEHKEQLKS
FT                   REKKQSKMEQSGLSEEELLRQQQELFRSATEKYHAAPE"
     atgtcagatc gcgaatttag tgcgaacgac gacttgtcgc tacctaaagc gacggtccaa        60
     aagatcatca ccgagatcct acctccttca tccggccaga cattctccaa agatgctcgc       120
     gatctcctca tggaatgctg cgttgaattc atcactttga tctcttccga agcaaacgat       180
     atcagtgaaa aggaagccaa gaagaccatc gcctgcgaac atgtcgagcg cgccctccgt       240
     gatctcggtt tcagcgacta catccccgat gtccttgctg tcgcggagga acacaaagag       300
     cagttgaagt cgcgagagaa gaagcagagc aagatggagc agagcgggtt gtccgaggag       360
     gagcttctac ggcagcaaca ggagttgttc cgctcagcta ctgagaagta tcacgctgct       420
     ccggagtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page