(data stored in SCRATCH zone)

EMBL: AM269952.PE36

AM269952.PE36        Location/Qualifiers
FT   CDS_pept        complement(join(75845..78784,78898..79464))
FT                   /locus_tag="An01g01110"
FT                   /EC_number="3.5.2.-"
FT                   /note="Function: Pseudomonas sp. hyuA is involved in the
FT                   conversion of D-5-substituted hydantoins to corresponding
FT                   N-carbamyl-D-amino acids."
FT                   /note="Title: strong similarity to D-amino acid hydantoin
FT                   hydrolase hyuA - Pseudomonas sp."
FT                   /note="See PMID 1732229"
FT                   /db_xref="GOA:A2Q7L1"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L1"
FT                   /inference="profile:COGS:COG0145"
FT                   /inference="profile:PFAM:PF01968"
FT                   /inference="profile:PFAM:PF05378"
FT                   /inference="similar to AA sequence:PIR:B42594"
FT                   /protein_id="CAK43487.1"
FT                   /translation="MASTNEFRLGVDVGGTFTDVCVFTPNGETVRAKVPTTPNQTIGIR
FT                   HGIAKVRRVLKERYNWDGTFRFIHHGTTTATNAVLEGKGARTALVVTAGHKDILAVRRS
FT                   QIPGGLGAWLYYTPPEPPVPLERVVQCAERMSVSGETVVEVDGERLKGDLLELMERERP
FT                   EAVAVSLLSSYKNPAHEEAVAKIIRENYLRELSEQLASETEAIRVLKSDGGLTSVGLAG
FT                   KFPVNILMSGPAGGAKGVADAVARSTPYKNLITLDMGGTSTDCALILDGKPRIRRDTVV
FT                   DTLTVRAPAVDIHTVGAGGGSIATYMELTETLRVGPESAGAAPGPACYGKGGTEATVTD
FT                   ANLVLGYLPHTLLDGEFCLDTEAAKTAIQKLATAMDLPLRQTAENIINIVNETMYGAVR
FT                   LVSVEQGYDPRDFALVAFGGAGPLHANAVGKLLGAWPVIVPPSPGILCAQGDLTTKLSH
FT                   EQSVTFTRLVRDTSSEELQRQVDELEKHCEQIMRESCGSDWPMPLVATYEVDVRYKGQA
FT                   LTITINLLPDEIQLDDQAWRCVLQDAFNKKHQQQFGYCLPDFELELMRIGVTLVDGSSD
FT                   VELPVVPKAESSEPTSSAVIGTQIIIIEGQEQVATVWEREKITLEGIRVTGPCIITEMD
FT                   SNTLILPGYSGEIDRLGNILIQPIAKQPSPTTQHTSDSAADLMHSNPLIATLVASSLAC
FT                   IRGEMDKLMLRCSMSPAIREQQDEFNVITTAEGKMLVGQFGSFIKEFLEVWTGSIEEGD
FT                   VFITNDTYMVKGAVSHLNDVIIILPIFHEHRLIGWASQFGHLTDVGGMVPGSLSINATS
FT                   IYDDGVQIPCIKLYSRGVMNSDLVDLLCRNSRQPAWYRSDLTALVTACRMAATRISELA
FT                   TRFGTEVYLAACQELLLRNRTGLAKIVERQFDDQLSTFTDFVDDDGHGVGPWAVTCSMQ
FT                   KTSAGGLKFDWSGTSPQSEHSINFYLSETMFKMLVGYYLIAAAAPGTVINNGFHDLIEV
FT                   RIPEGTVLKPVRPAAISCRTHFLGRTMDVIQALIGQKNEAYVAAAGFSDSPHFFYSGYY
FT                   PSGEWYQLYQIGFGGVPARAAGDGLDCHCLFPAIKSIPTESIELNYPLRIEANESVADS
FT                   GGPGYFRGGNAQRTLYRFLAKGEISLHDDRWFTNHGVSKGGSRDNVRGRSCIGILAVPI
FT                   VQ"
     atggcatcga ccaacgaatt ccgccttgga gtcgacgtcg gcggtacctt cactgacgtg        60
     tgcgtcttca ctccgaacgg ggagacagtc cgcgccaaag tccccaccac gcccaaccaa       120
     acgatcggga ttagacacgg gatcgcgaaa gtgcgacggg ttctcaagga gcggtataac       180
     tgggatggga catttaggtt cattcatcat ggtaccacca cggcgacgaa tgccgtgtta       240
     gaaggcaaag gggcgcggac tgccctggtg gtcacggctg ggcataaaga tattctggct       300
     gtgaggcgct cgcagattcc tgggggcctt ggagcgtggc tttattacac ccctcctgag       360
     ccgccggtgc cgctggagag ggtggttcag tgtgcggaga gaatgtcggt tagtggggag       420
     acggtggtgg aggtggatgg cgagaggctg aagggggatt tgctagagtt gatggagcgg       480
     gagaggcctg aggcggtggc agtttcgttg ctgagttcgt ataaaaatcc tgctcatgag       540
     gaggctgttg cgaagataat tcgagagaat tatctgcgcg agctgtccga gcagttggcg       600
     tcggagaccg aggcgattcg ggtgttgaag agtgatggtg gcttgacgag tgtcggcctg       660
     gctgggaaat tccccgtgaa tatcttgatg tctggaccgg ctggaggagc caaaggagtg       720
     gctgatgcgg tcgctcgaag caccccgtac aaaaacctca ttactctcga catgggaggg       780
     acttcgacgg actgtgcgct cattttggat gggaagccac gtatccgtcg agatactgtt       840
     gtcgataccc taacagttcg tgcaccggcc gtagatattc ataccgttgg tgctggaggt       900
     ggctcaatcg cgacatatat ggagctcact gagaccttgc gggttgggcc agagagtgct       960
     ggggcagcac caggtccagc ctgttatgga aaagggggaa cagaagcgac ggtcaccgat      1020
     gcaaatctcg tcttgggata tttgcctcat actctattgg atggtgaatt ctgcttggat      1080
     accgaggcag caaagaccgc gattcagaag cttgccacgg caatggatct tcctctcaga      1140
     caaacggcag agaacataat taacattgtc aatgaaacaa tgtatggtgc tgttcgattg      1200
     gtctctgttg aacagggata tgatccaaga gactttgcac tcgttgcctt tggtggtgct      1260
     ggacccctgc atgccaatgc tgtaggaaag cttctaggcg cgtggcccgt cattgtccct      1320
     ccgtctccag gcattctgtg tgcacagggc gatctgacaa ccaagttgag tcatgagcag      1380
     tccgtgacct ttactcggct tgtgagagat acctcgtcgg aggaactgca acgtcaggtg      1440
     gatgaactgg aaaaacactg cgaacagata atgcgagagt cttgtggttc agactggcct      1500
     atgccattgg ttgccacgta cgaggtcgat gtccgataca aaggacaggc tctaaccatc      1560
     accatcaacc tcttgcccga cgaaatccaa ctagatgatc aggcttggcg ttgcgtttta      1620
     caagacgcat tcaacaaaaa gcatcaacag caatttggct attgtcttcc cgactttgaa      1680
     ctcgagctga tgcgtatcgg cgtaaccctc gtggacggct cctcagatgt ggagctgcca      1740
     gtagtcccta aagcggaatc tagcgagcct acatcctcgg ccgtcattgg cacgcagatt      1800
     attatcatcg agggccaaga acaggtagcg acggtgtggg agcgagagaa gatcacgctc      1860
     gaaggcatcc gggttacagg accctgcatc atcacggaaa tggacagcaa cacactgatt      1920
     cttccaggct attcaggtga gatcgatcgg ctcggcaata ttctcatcca gccgattgca      1980
     aagcaaccat ccccaacgac gcagcatacc tcagactcag cagcagactt gatgcacagt      2040
     aacccgctca tcgcaactct ggtagcctct tcactggcat gcatccgtgg cgaaatggac      2100
     aaattgatgc ttcgctgcag catgtcccct gctatccgcg aacagcaaga cgaattcaat      2160
     gtcatcacaa ctgcagaggg caagatgctc gtaggccaat tcggcagctt catcaaggag      2220
     ttccttgagg tgtggacggg aagtatcgaa gaaggcgatg tgttcattac caatgacaca      2280
     tacatggtca aaggggctgt cagtcacttg aacgatgtga ttatcatcct tcccatcttt      2340
     catgaacatc ggttgatcgg ctgggcttct caatttggac acctgaccga tgtcggcggc      2400
     atggttccgg gaagcctgtc catcaacgcc acctccatct atgacgatgg agtccagatt      2460
     ccatgtatca agctctactc ccgaggggtg atgaacagtg acctagtcga tctgctatgt      2520
     cgaaactccc gtcaaccggc atggtatcga tcggatctga cggctctggt gacggcatgt      2580
     cgcatggcag caacgcgcat ctccgagctg gccacccgct tcggaaccga ggtgtatcta      2640
     gctgcctgtc aggagctcct acttcggaat cgaacgggtc tagccaagat tgtagagcgt      2700
     cagttcgacg atcaactcag cacatttacc gactttgtcg atgacgacgg ccacggcgtt      2760
     ggaccctggg ccgtaacatg ctcaatgcag aagaccagtg cgggagggtt aaagttcgac      2820
     tggagtggta cttcgcccca gagcgagcac agcatcaact tttacctctc cgagaccatg      2880
     ttcaagatgc tcgtcggata ctacctcatt gccgctgccg ccccgggaac cgtcatcaac      2940
     aacgggttcc acgacctcat tgaagtgcgt atccccgagg gcaccgttct aaagccagtc      3000
     cgccctgctg caatttcctg tcgcactcac ttcctaggtc gaaccatgga cgtgatccaa      3060
     gcgctgatcg ggcagaagaa cgaagcctat gtagcggcag ctggattcag cgactcgccc      3120
     catttcttct actccggata ctatccctct ggagaatggt atcaactata tcagattgga      3180
     tttggtgggg ttccggcccg cgcagcaggc gacggactgg actgtcattg cttgttcccc      3240
     gccatcaagt cgattccaac ggagagcatc gagctgaatt acccccttcg gattgaggcg      3300
     aacgaaagtg tcgcagacag tggtggcccg ggatacttcc gaggaggcaa tgcgcaacga      3360
     accctgtatc gattcctggc gaaaggagag atcagcctgc atgatgatcg gtggttcacg      3420
     aaccatgggg tctcaaaggg gggaagccgg gacaacgttc gcggaagatc ttgtatcggt      3480
     atcctcgcgg tgccgatcgt ccagtga                                          3507
//

If you have problems or comments...

PBIL Back to PBIL home page