(data stored in SCRATCH zone)

EMBL: AM269952.PE37

AM269952.PE37        Location/Qualifiers
FT   CDS_pept        join(80271..80390,80459..80560,81255..81606,81699..81775,
FT                   82374..82381,82531..82589,82668..82822,82859..82902,
FT                   82988..83100,83318..84316,84706..84761,84823..84938,
FT                   85016..85040)
FT                   /locus_tag="An01g01120"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An11g03480 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7L2"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L2"
FT                   /protein_id="CAK43488.1"
FT                   /translation="MSVRKREMQVSDVKPTSRPFSSQHSSRRNSFPPISADPFNDPTKD
FT                   RIIKLESPIRSQEKVTLVIFPEKKGRQTNIFCSIYFIPVLNGMLVERAPTLCTLECDIS
FT                   QIRLLLLNQFAMDAIQQFLYVFPEPAPHKGTEPVEELCLGLPRTGIESLSVGLQKLGLD
FT                   TYHGWDLVFEPHGRKLQCCHELVKRNHHAPELLVAYPGAKVILNGRRDVSQIVRLARYA
FT                   LVLRALISIVSIAYTCPVTSPTGMYPNVEPQNFEDWDQGNFQGCGNCAGVEPEHPSVDL
FT                   CIIVFYFSTYLAFVGDIAITTIPYGPGPFGALLLSHPSEFTAESIFELDHPKSCHLCRL
FT                   SPAMPTPEDIDQWLEETFIVHPEAEYNVTSAEKLALSLPPSPFFKLHWVPASRELIFRT
FT                   PHWRTDGAGLMMLQDAFLTLLSSPAEEINFDGSEISRLPPTMNELFCSGFEATEETKKA
FT                   FDGEWQAVFDPSLKPLSWVKHALPGTIPGSTVRLSHKFSKDETKQLITEIKKRGITVTN
FT                   GMASAFMVTAANHATPADGRFILLNPFNVRRYLPAPWNGTAGAGATYHTGRLQSFNLED
FT                   GKDYESACRAVTEFYNRGIKDAFSFMPLLIQAATSLVDTPAEVANSGNGSASVDLSQLG
FT                   LVDDLLQTRYEGPRYTLEIEDWWTGVEFVTKKLQGYTWTRDVNVKAVYIALDSLFNFAM
FT                   QISYMLEAQARPGRGESSHMTKAVSCDPLLRTSLEFKAERYILTLRK"
     atgtcagtcc ggaagcgaga aatgcaagtc agcgatgtga agcccacttc tcgtccattc        60
     agttctcaac actccagccg tcgaaactca ttccctccga tctcggcaga ccctttcaac       120
     gatccgacta aggatcgtat cattaaactg gaatccccga ttcgaagtca ggaaaaggtt       180
     accttggtaa tatttccgga gaaaaaaggt cgccagacaa atatattttg ttcgatctat       240
     ttcatcccgg ttctaaatgg tatgctagtg gaaagagctc ccaccctgtg cactctcgag       300
     tgtgacattt ctcaaattcg actacttttg ttaaaccaat ttgcaatgga tgctatccag       360
     caatttctct acgtattccc tgagccagct ccacacaagg gcaccgagcc tgtcgaggag       420
     ctatgtttag gcttgccacg cacagggatc gaatcgctaa gcgtgggttt acaaaaacta       480
     ggccttgaca cgtaccatgg ttgggacctg gtcttcgagc ctcatggccg caagttacaa       540
     tgttgccacg aactagtgaa acggaatcac cacgccccag aactattggt cgcttacccc       600
     ggtgctaaag tgatcctcaa cggacgtcgt gacgtgtcac agatcgttcg tctagctaga       660
     tacgccttag tactccgcgc actgattagc attgtatcca ttgcatacac ctgcccagtt       720
     acttcaccca ctggaatgta tcccaatgtt gaaccccaaa actttgaaga ctgggaccag       780
     gggaactttc aaggttgtgg aaattgtgcc ggtgtggagc ccgagcatcc ttcggtggat       840
     ctatgtataa ttgtatttta cttctctaca tatcttgcgt ttgtcggaga tatcgcaata       900
     acgacaatac cgtatggacc aggtccgttt ggtgctcttc tactctcaca tccctcagaa       960
     ttcacagctg aatcaatctt tgagttggac catccaaaat catgccattt gtgcagacta      1020
     agcccggcca tgcctactcc agaagatatt gatcaatggc tcgaggagac ttttatcgtc      1080
     cacccagaag ctgaatacaa tgtcacttcc gctgagaaat tggctcttag tcttcccccc      1140
     tctccgtttt tcaaactcca ttgggtccct gcatcgcgag agcttatctt ccggacaccg      1200
     cattggcgca cagatggagc gggtttgatg atgttgcaag atgctttctt gacacttctg      1260
     tcctcaccag ccgaagaaat caattttgat ggatctgaaa tctcgcgtct tcctccgaca      1320
     atgaatgagt tgttttgttc tggttttgag gctacagaag agactaaaaa ggcgtttgat      1380
     ggcgagtggc aagcggtttt tgatcccagc ctgaagccac tgagttgggt caaacacgct      1440
     ttgcctggca caatcccagg atcgacagtt cggctcagcc acaaattctc taaagatgag      1500
     actaagcagc ttatcactga gatcaagaaa cgcgggatta ccgttacgaa tggtatggcg      1560
     agtgctttca tggttacagc agccaatcat gcgacccccg cagatggccg ctttatttta      1620
     ttgaaccctt tcaatgtgcg gagatatctc ccagcccctt ggaatggcac agcgggtgca      1680
     ggtgctacgt accatacagg tcgactgcag agtttcaacc tagaagacgg gaaggattac      1740
     gagtctgctt gtcgggccgt gaccgaattc tataatcggg gcattaaaga tgcattcagc      1800
     tttatgccgt tgcttatcca agctgctact tctttggtgg acactcccgc tgaggttgcc      1860
     aattcaggaa atgggtcagc atctgtagat ctgagccagc ttggcctcgt tgacgatcta      1920
     cttcagacgc gttacgaagg gccaagatat acgctcgaga ttgaggactg gtggacgggt      1980
     gttgaatttg tgaccaagaa actgcaagga tatacatgga ctcgtgatgt taacgttaaa      2040
     gctgtatata tagcattaga tagcttgttt aactttgcta tgcagatatc ctatatgtta      2100
     gaggcacaag cgcgacccgg gaggggagaa tcgagtcaca tgaccaaagc cgtgtcatgt      2160
     gaccccctac ttcgcacctc gctggagttc aaagcagaac gatatatatt gacattaaga      2220
     aaataa                                                                 2226
//

If you have problems or comments...

PBIL Back to PBIL home page