(data stored in SCRATCH zone)

EMBL: AM269952.PE39

AM269952.PE39        Location/Qualifiers
FT   CDS_pept        complement(95258..96598)
FT                   /locus_tag="An01g01140"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   encoded by An01g12050 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7L4"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L4"
FT                   /protein_id="CAK43490.1"
FT                   /translation="MTWSQVSAHRWERPGDGLENYFALTASLSAAAYDGRRHYTIFTKL
FT                   QLELDMPATEVECSLKKAWVQLRYEQPQIATVHNGTTKVYEVPDDTALQAWIASTVIIS
FT                   AAANAEDLYASITPIAQATLYYLPASSQLVLRTPHDTIDGIGVIRLLDRLLSILVSPPA
FT                   EKITFGDEPSRLAPTLREILGVAEQPTPEESDRMMALWKPYIDHAPGIGPVSNLGNRPA
FT                   GQSQHARLDVPTRTTEAIIQACKAKNITVTSAVHAAYIETIKKHADPDHPSCHYVNTAQ
FT                   FNLRPYLPKHGSQYTASLGYTLFPVHLESPSSFGPTAQALNQFYRTTFADDPSKLPLVP
FT                   HMTDLLFAVTQNPEYQKGPFPRDAIPSSLGIIENHMRRSYGTNKVIVRDFMLGVDVVMG
FT                   MNMLSISTFRDQLQLVYSFNDAYHEPEHISQYLQEIVTVLTKELLAN"
     atgacctggt cacaagtgtc agcccaccgc tgggagcgcc caggcgatgg tcttgagaac        60
     tactttgccc ttaccgcatc tctttctgcc gctgcctacg atggcaggcg tcattacacc       120
     attttcacca aactccagct tgagttggac atgccggcaa ctgaggtgga gtgctcgttg       180
     aagaaggcct gggtgcagct gcggtatgaa cagccccaga tagccacagt ccacaacggc       240
     acgaccaaag tctatgaggt gcccgacgac acagccttgc aggcttggat tgcctcaacc       300
     gtgatcatat ctgcagctgc caacgcggag gacctgtacg ccagtatcac acctattgcg       360
     caggctacac tatactacct ccctgcctcg tctcaattgg ttttacgtac ccctcacgat       420
     actattgatg gtatcggggt cattcggttg ttggaccggc tgctaagcat cctagtgtct       480
     ccacccgcgg agaagatcac attcggcgat gaaccctccc gattggcacc tacccttcgt       540
     gaaattcttg gggtggctga gcaaccgacc cccgaggaat cagacagaat gatggcactt       600
     tggaagcctt acattgatca tgctcctggc atagggcctg tctctaacct cggcaatcgt       660
     ccggccggcc agtcgcagca tgcgaggctg gatgtcccca cacgaaccac tgaggccatc       720
     atccaggcct gcaaagcgaa aaacatcact gttacttccg cggtccatgc agcctacatt       780
     gagacgatca agaagcacgc cgatcccgat catccatcgt gccattatgt caatactgca       840
     cagtttaatc tccgccccta cctgcccaaa catgggtcgc agtacactgc ctcgcttggt       900
     tacaccttgt ttcccgtgca cctggagtct ccatcttcgt tcggtcccac ggcacaggct       960
     cttaaccagt tttaccgaac gactttcgcc gatgatccca gtaagctgcc cttggtgccg      1020
     catatgaccg accttctgtt tgctgtcact cagaacccgg agtaccaaaa ggggcctttc      1080
     ccaagagacg caatccccag tagcctggga atcattgaga accacatgcg acggtcttac      1140
     ggaaccaaca aagtgatcgt tcgcgatttc atgctcggag tcgacgttgt gatgggcatg      1200
     aatatgttgt ctatctccac cttccgggac caactgcagc ttgtgtacag cttcaatgac      1260
     gcgtaccatg agccagagca tatctctcag tacctgcagg aaattgtgac ggttctcaca      1320
     aaggagctat tagcaaacta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page