(data stored in SCRATCH zone)

EMBL: AM269952.PE40

AM269952.PE40        Location/Qualifiers
FT   CDS_pept        join(96859..97069,97091..97374,97437..98342,98740..98877)
FT                   /locus_tag="An01g01150"
FT                   /note="Function: M. grisea Pth11p can activate appressorium
FT                   differentiation in response to inductive surface cues and
FT                   repress differentiation on poorly inductive surfaces using
FT                   multiple signaling pathways to mediate differentiation."
FT                   /note="Remark: the adjacent genomic region contains another
FT                   predicted A. niger protein with similarity to M. grisea
FT                   PTH11."
FT                   /note="Similarity: similarity is from the N-terminal region
FT                   of the predicted A. niger protein to the N-terminal region
FT                   of M. grisea PTH11, which is 100 aa longer."
FT                   /note="Title: similarity to surface recognition protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /note="localisation:plasma membrane"
FT                   /note="See PMID 10521529"
FT                   /db_xref="GOA:A2Q7L5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L5"
FT                   /inference="similar to AA sequence:UniProtKB:AF119672.1"
FT                   /protein_id="CAK43491.1"
FT                   /translation="MPWGFSTQPPQRLFPLLPLFALADCCVISFGLSYCRQHFGTVTRP
FT                   GSPEADRETDGGNKAQLPPTSFTPARQVLHRILFIGSQQPSLLSFVLLVTKFTLFALAC
FT                   FTVLFMALDIPKDTPDCGEGILITSIFLIILIIIFTVLRVVSKFVTHQDWWWDDFFALL
FT                   ALPFELIVLSLVVAWRQIGLGYHMEVVAAINPEYLLTGARYLYVAIFFFDGSVCLPKIS
FT                   ALFFYARIFRTNNRTFRIHLWIVGGLTSTWLLAAWISTGLECQPIAKAWNTVLPGTCIA
FT                   QFQWYLSTAALSCMIDFYILFLPIPMIWGLQASLKRRVYLLIAFMMAYSVVVLSLGRLV
FT                   AVIQFIPIMNQDLTWHFVKYGYWSILEGSISIISISVPSCLALAKALRNTSDPKIYLDS
FT                   NKASTNSPSYISSHFGEQKDTVSWQNGHSGCGSVDKLVSDIHVSPGEYGHHRNLDIPLG
FT                   AVRIETDIEPSAGLQLSGGRFDRNDMGISQYLLNLLTTCSQILPGYYEEVSAGR"
     atgccttggg gcttctccac ccagccccct cagcgtcttt tccctctcct tcccctcttt        60
     gctttagctg attgctgcgt aatttcattc ggcctttcat actgccgtca gcattttgga       120
     accgtaacga gaccagggtc ccctgaggct gacagggaaa cagacggtgg aaacaaggcg       180
     cagctgcctc caacttcatt cactccggcc cgccaggtcc tacaccgtat cttatttatt       240
     ggctcccagc aaccttcact tttgtccttc gtcctcctgg tcacaaagtt cacattattt       300
     gccttagctt gctttactgt gctcttcatg gcactagaca tccctaaaga tactcccgac       360
     tgcggagaag ggattttaat cacatcaatc tttcttatta ttcttattat aatatttaca       420
     gtgcttcggg ttgtcagtaa gtttgttact catcaagact ggtggtggga tgacttcttc       480
     gctctccttg cattaccgtt cgagttaatc gtcctctccc tcgtggtggc gtggagacaa       540
     atcggcctcg gttatcatat ggaggtagtg gccgcaataa acccagaata tcttcttacc       600
     ggcgcccgtt atctctacgt ggcaattttt ttcttcgacg gctcagtctg tttgccaaag       660
     atttcggcct tgttcttcta tgcccgcata tttcgaacaa ataaccgcac cttccgcata       720
     catctctgga tcgtgggtgg acttacatct acatggctct tggcagcctg gatctctacc       780
     ggtcttgaat gtcagcccat tgcaaaggcc tggaatactg tattaccagg aacatgcatt       840
     gcccagtttc aatggtattt atcaacggcc gctctctcgt gtatgattga cttctacatc       900
     ttgttcctcc cgattcccat gatttggggt ctgcaagcca gtctgaagcg ccgtgtatat       960
     ctcctgattg ccttcatgat ggcttactca gtcgtggtgt tatcccttgg ccgcctcgtt      1020
     gctgtcatcc aattcattcc tatcatgaat caggacctca cttggcactt tgttaaatat      1080
     ggctactggt ctattctcga gggatcgatc tctatcatct ccatcagtgt tcctagttgc      1140
     cttgccttag cgaaggctct acggaatact tcagatccaa agatttattt ggatagtaat      1200
     aaagctagta caaactctcc tagctatatt agctcccatt tcggtgagca aaaggatact      1260
     gtctcctggc agaatgggca ctcgggttgc ggcagtgtcg acaagctcgt ttcagatatc      1320
     catgtcagcc cgggtgagta tgggcatcac cggaacttgg atatcccact tggcgcggtc      1380
     cgcattgaaa ccgatatcga gccttcagca ggtcttcagc ttagcggggg tcgtttcgat      1440
     aggaatgata tgggaataag ccagtatctt cttaacttat tgacaacatg ctctcagatt      1500
     ttacccggtt actatgagga agtaagtgca ggcaggtag                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page