(data stored in SCRATCH zone)

EMBL: AM269952.PE42

AM269952.PE42        Location/Qualifiers
FT   CDS_pept        102437..103654
FT                   /locus_tag="An01g01170"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   BAC47708.1 - Bradyrhizobium japonicum"
FT                   /db_xref="GOA:A2Q7L7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L7"
FT                   /protein_id="CAK43493.1"
FT                   /translation="MKTFTSALIGAAALAQNVNSSLLSGPAGLEFPNVTGLMNHTVHVS
FT                   NGGSAHCISGIVKVNATTDKNLKFAYNLPSNQSQVTRTLVSLWSSGGDGYVKSLTSGTQ
FT                   RITGSYDIEATYCLPAGENSKTTKVQLLTHGIGVDRHYWDFASGYSYVDTAAAAGYATF
FT                   LYNRLGVGASSKEDPLNAVQSPLELEILEALASKLRQGTLGDRAFTTVVGVGHSFGSIL
FT                   TQGVTAAYPKTLDAAVLTGFTLNSNGLPGFGLGLNAAIASETQPYRFSGLSTGYLVAGT
FT                   PVSNQIAFFYDPGFDPEILSLADATKGSFTLGELFTLTHVINATSEFQGPVAVVAGNED
FT                   LPFCNGNCSSPSNILAGLVPALYPEVSEENTATYVAPAVGHALNLHYAAPGAFNFIQDF
FT                   LKKHNV"
     atgaagacct tcacttctgc cttgatcggt gctgctgcat tggcacagaa cgtcaattcc        60
     tctcttcttt ctggccctgc tggtctggaa ttccccaatg tgaccgggtt gatgaatcat       120
     accgtccacg tttccaacgg cggatcagcc cattgcatct ccggtatcgt taaagtcaat       180
     gcaacaaccg acaaaaacct caagttcgcg tacaacttgc cctctaatca gtcgcaagta       240
     actcggacac tcgtcagcct gtggtcgtca ggcggggatg gctacgtgaa atccctcacg       300
     agcggcaccc aacggatcac cggcagctac gatatcgagg cgacatattg tctgcctgca       360
     ggcgaaaact caaagacaac caaggtccag ctcctcacgc acggtattgg cgtggaccgc       420
     cactactggg actttgcctc gggatatagc tacgtcgaca ccgccgcggc cgcagggtat       480
     gccacattcc tgtacaaccg tctcggcgtt ggcgcatcgt cgaaggaaga cccattgaat       540
     gccgtgcaat cgccacttga gctggagatt ctcgaggcac tggcaagcaa gcttcgccaa       600
     ggtacccttg gtgaccgcgc ctttacgact gtcgtgggtg taggccactc gtttgggagc       660
     atcctgaccc agggtgtcac cgcggcttac ccaaagaccc tcgacgccgc agtgttgaca       720
     ggatttacac tcaattcgaa cggtctgcct ggttttggcc tgggtcttaa tgcagccatt       780
     gcctcggaaa cccagccgta ccgcttcagt gggctctcta ctggatacct tgtcgctggg       840
     acgcccgtgt cgaatcagat tgcgtttttc tacgaccctg gttttgaccc cgaaatccta       900
     tcgctggcag atgccaccaa gggaagcttc acgctgggtg aacttttcac gttaacgcac       960
     gttatcaatg caacgagcga attccaaggt cccgttgcgg tcgttgctgg aaatgaagat      1020
     ttgcctttct gtaacgggaa ctgcagttct ccgtccaata ttttggctgg tcttgtgcct      1080
     gcgctgtatc cggaagtatc agaggagaat actgctacct acgtggctcc tgctgtaggt      1140
     cacgccttga acttgcatta tgcggcgccg ggtgctttta acttcattca ggactttctc      1200
     aagaagcaca atgtgtaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page