(data stored in SCRATCH zone)

EMBL: AM269952.PE43

AM269952.PE43        Location/Qualifiers
FT   CDS_pept        complement(join(105008..105231,105263..105640,
FT                   105700..106376,106503..106675))
FT                   /locus_tag="An01g01180"
FT                   /note="Similarity: the C-terminal region of the predicted
FT                   A. niger protein contains a chromate transporter motif."
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein CAD21291.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q7L8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L8"
FT                   /inference="profile:COGS:COG2059"
FT                   /inference="similar to AA sequence:UniProtKB:NCG15G9.4"
FT                   /protein_id="CAK43494.1"
FT                   /translation="MPAQPTRHAQKSPFLNAWARSCDIPGIWDLRLLGVRRFISRFFTR
FT                   GLSNRKSGLMSRRFTPVSSRPYWHLSYGGMSTALIASLAIRNDGLISFTSLPGAVGMYA
FT                   LSLGVQRIDETLPAAVYALLSGLNASTVGIVALAAVQLAEKAIRDKIARILVIFGACAG
FT                   LCYSALWYFPVLMVAGGVTTALWDGWIYQQILRARMAWKNRNRQPEPEGDEPGSAGRES
FT                   SSMQSPEQGARIEMLRMRKSGAEASPPNSTNIQAPEGGEAAPAWEHIIRIRVGAAILIF
FT                   FFASFIAILVTRAKLSAPPLSLELFANMYLAGTVIFGGGPVVIPLLRSYVVDPGWVSSR
FT                   DFLIGLAIIQAFPGPNFNFAVFLGALAVRTTSYPTVFGAFLCGLGIFFPGITLAVAIQS
FT                   FWRVLRKQVYSVGLVFTAVYRLWEIGYLTPQDRDGQSLAKEPWWVVIAAVTYAQSAWFK
FT                   VPPAVAIVLGAVLGLCWYEVVSPAW"
     atgccggcgc aaccgacccg gcacgcgcag aagagcccct tcttgaacgc ttgggcgagg        60
     tcgtgcgaca tacctggtat ctgggattta cgtcttttgg gggtccgccg gttcatttcc       120
     agatttttca cgcgcggttt gtcgaacagg aaaagtgggt tgatgagcag acgcttcacg       180
     ccggtttcat cccggccata ctggcatttg tcctatggtg gtatgtctac tgctttaatt       240
     gcgtcccttg ccattcggaa tgatgggctg atcagtttta ctagtcttcc cggcgcagtc       300
     ggtatgtatg ccctctctct cggcgtgcaa cggatcgacg aaacactgcc cgcggcagtc       360
     tacgctcttc tctccggtct aaatgcctcg acagtaggca ttgttgccct cgctgccgtc       420
     cagctagctg aaaaggccat ccgtgataag attgcccgca tcctggttat tttcggtgca       480
     tgcgcaggcc tctgctatag cgcgctctgg tatttcccag ttcttatggt tgcgggtggt       540
     gttactacgg cactgtggga tggttggata tatcaacaaa ttctcagggc aaggatggct       600
     tggaaaaata ggaatcggca gcccgaaccg gagggtgacg agcctggatc ggcaggccgc       660
     gagagttcgt ccatgcaaag cccagaacag ggtgctagaa tagagatgct acggatgagg       720
     aagtcaggtg cagaggcatc ccccccgaac tcaaccaata tccaggcccc ggaaggaggg       780
     gaagccgcac ctgcatggga gcatatcatt cggatccgtg taggggctgc aattcttatc       840
     ttcttctttg cgtccttcat cgccattctt gtcacaagag ccaaactctc cgcaccgcct       900
     ctatctctcg aactcttcgc gaatatgtac ttagctggca ctgtgatctt cggcggcggc       960
     cccgtcgtta tccccttgct ccggtcatac gtcgtagacc cgggttgggt ttccagtcga      1020
     gacttcctca tcggccttgc aatcattcag gccttccccg gcccaaactt caactttgca      1080
     gtctttctcg gtgctcttgc cgtccgaaca acatcctacc cgacagtctt cggtgccttc      1140
     ctctgtgggc tagggatctt ctttcctgga attaccctcg ccgtcgcaat ccagtccttt      1200
     tggcgtgttc tgcggaaaca agtatattct gttggattag tgtttacagc tgtgtaccgg      1260
     ctttgggaaa tcggatatct aactccgcag gatcgtgatg ggcagagtct ggcgaaggag      1320
     ccctggtggg ttgttattgc cgctgttaca tatgcccaga gtgcatggtt caaggtcccg      1380
     cctgcggttg caattgtgct aggtgctgtg cttgggttgt gttggtatga agtcgttagt      1440
     cctgcctggt ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page