(data stored in SCRATCH zone)

EMBL: AM269952.PE44

AM269952.PE44        Location/Qualifiers
FT   CDS_pept        107534..108166
FT                   /locus_tag="An01g01190"
FT                   /note="Similarity: the predicted A. niger protein contains
FT                   a phosphoglycerate mutase motif."
FT                   /note="Title: similarity to hypothetical phosphoglycerate
FT                   mutase SPAC5H10.03 - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q7L9"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L9"
FT                   /inference="profile:COGS:COG0588"
FT                   /inference="similar to AA sequence:PIR:S55481"
FT                   /protein_id="CAK43495.1"
FT                   /translation="MALKVHLVRHAESVHNVTHDFSQLDPELTPLGLQQATGLGQLFPY
FT                   APQVGVIITSPLKRAIQTTLTAFSHILDKRYFDPDSGDGVENGAVLFLEPDLQERSALP
FT                   CDTGSPTRVLEAAFPRLGFQDLAEGWQVKEDFYSPADEAVEERAQRMRSRIAAVCEDLQ
FT                   HQGRTDVVVVTHGVFMKFLSGDPDIDLPKAGWRSYAVGTGTVFSKCS"
     atggccttga aggtccatct cgtccgccac gccgaatcgg tccacaatgt cactcatgac        60
     ttctctcagt tggatcctga gttgacccct cttggccttc agcaagctac agggctcggc       120
     cagctattcc cctacgcccc ccaggtgggt gttatcatca cctctccact caaacgagct       180
     atccaaacca ccctcacggc tttttcccat attcttgata aacggtattt cgaccccgac       240
     tctggggacg gagtggagaa tggcgcagtc cttttcttgg aaccggattt gcaagagaga       300
     agtgcccttc cctgtgatac ggggtcccca actagggtcc tggaagcggc ttttccgaga       360
     ctaggtttcc aggatttggc tgagggttgg caagtgaaag aggacttcta ttctcccgcc       420
     gacgaagctg tggaggagcg ggcacagagg atgagatctc gtattgccgc agtttgcgag       480
     gatctgcaac accaaggacg gacagacgtt gtggttgtaa ctcacggggt gttcatgaaa       540
     ttcttgtcgg gagacccaga cattgatctg ccgaaagcag gctggaggag ctatgctgtt       600
     ggaactggaa ccgtcttctc gaagtgctcg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page