(data stored in SCRATCH zone)

EMBL: AM269952.PE45

AM269952.PE45        Location/Qualifiers
FT   CDS_pept        complement(join(108631..110202,110261..110626))
FT                   /locus_tag="An01g01210"
FT                   /EC_number="3.4.19.1"
FT                   /note="Function: R. norvegicus acyl-peptide hydrolase is a
FT                   serine protease which catalyzes the removal of an N
FT                   alpha-acetylated amino acid residue from an N
FT                   alpha-acetylated peptide."
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   strong similarity to several putative mikrobial
FT                   acyl-peptide hydrolases."
FT                   /note="Title: similarity to acylaminoacyl-peptidase -Rattus
FT                   norvegicus"
FT                   /note="See PMID 2722805"
FT                   /db_xref="GOA:A2Q7M0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M0"
FT                   /inference="profile:COGS:COG1506"
FT                   /protein_id="CAK43496.1"
FT                   /translation="MVTDPNDKAQLNLQALADLQVPRDLSISPDGSRIAYALQPLSKKG
FT                   DHATSSIWIATVDKEYSSRQFTSGLFNDEQPQWSPAGTLIAFKSDRHRPGKSSAIYVLP
FT                   VDGGEAYPVTPVDCEKPIKTEEQVSKEKVKMIQLFGGKDLEYSRLRIAHVATGQIRTIV
FT                   AGHRHVHDFTWSPDSTQICFVAHKGPDINSAGFYGAEILITSISGSEEKLVAQFPGPIS
FT                   QIAWGNCGVFFIAGHVPTHCLTSLSLYELNIEYGSYTERKDGDEAHCCITLRKNQSCLS
FT                   YRVQRYLNDEFFSISDDGTRTKAYSEKCEMSSFDVLKTTDSSDIIAITRGDGSNPEEVF
FT                   SISKSTGPVKLSAHNSSIAALEISKSWSISNYARDGYYLDGMMYVPSAYKFEDGPLPTI
FT                   LIPHGGPYWRVTTGFAVCHCLEVPVLVSMGYAVLCPNYRGGSGRGEAHAAYARGGVGTV
FT                   DYTDCIDLLQYSIARGSVDPARVAIAGWSQGGFLSYFAVTREEFQFRGAICGAGISEWN
FT                   SMAMMSDAYWMQGEVVGGAPWDVDTNLKPGEEDSITSPEKRWIGDTNGRRGSALWHMRN
FT                   VKTPILILHGEDDERVPLEQAIAFYRACVHNNVPVEMVTYPREGHFIVERRHLIDMWER
FT                   MRTFCYRNLQ"
     atggttactg atccaaacga caaggcccag ttgaacttgc aggctctagc cgacctccaa        60
     gttcctcgtg atctctccat ctctcccgac ggttctagga ttgcctatgc actacaacct       120
     ctcagcaaga aaggcgacca cgccacctca tcaatctgga tcgcgacagt cgacaaagaa       180
     tacagcagtc gccagttcac ttcaggctta ttcaacgacg aacagccaca atggtctcca       240
     gctggaacat tgattgcctt caaatcggat cggcaccggc caggcaaaag ctcagccata       300
     tatgtgttgc cagtcgatgg cggcgaagca tatcccgtaa cgccggtgga ctgcgagaag       360
     ccaataaaga cggaagaaca ggtttcaaag gagaaagtaa agatgatcca actgtttggg       420
     gggaaagact tggaatattc ccgcctgaga attgcccatg tagcaacagg gcagatcaga       480
     actatcgtcg ccggtcatag acatgttcat gacttcactt ggagccctga ttcaacacag       540
     atttgctttg ttgcccataa agggccggat atcaattcag ctggctttta tggtgcagaa       600
     atcctgatta catcgatctc cggatcggag gagaaactag tcgcccagtt ccccggacca       660
     atcagccaga tcgcatgggg aaactgtggt gtcttcttca ttgcaggtca tgtcccgacg       720
     cactgcctaa catccctttc cctatacgaa cttaatatcg aatacggttc atatacagag       780
     cgaaaagatg gcgatgaagc acactgttgc atcactctcc gcaaaaatca atcttgccta       840
     tcctaccgtg tccagaggta tcttaatgat gagttcttct cgatcagtga tgatggcact       900
     cgtacgaagg cctatagcga aaagtgtgag atgagctcat ttgacgtcct aaaaactacg       960
     gacagtagtg atatcattgc aataacgagg ggtgacgggt caaatcctga agaagtcttc      1020
     tccatctcga aatctaccgg tccagtcaaa ttgtcagccc ataattcctc catcgccgct      1080
     ctagaaatat ccaagtcgtg gtcaatttca aattacgcga gagatggata ctaccttgac      1140
     ggaatgatgt atgttccctc cgcatacaaa tttgaggatg ggccgctccc cactattctc      1200
     atcccgcacg gaggaccata ctggcgggta actaccggtt ttgctgtgtg ccattgtctc      1260
     gaggttccgg tattagtatc aatgggctat gccgttcttt gccccaacta ccgtggtggg      1320
     agcggtaggg gtgaagctca tgcagcttac gctcgcggag gagttggcac agttgactac      1380
     actgactgca ttgacctgct ccaatacagt atcgctaggg gcagcgtaga ccctgcgcga      1440
     gtggcaatag ctggttggtc acagggagga tttctatcct attttgcagt cactcgcgag      1500
     gagttccaat tcagaggagc catatgcggg gcaggtatat cagaatggaa ctctatggca      1560
     atgatgagcg atgcatattg gatgcagggt gaggtggttg gcggtgcccc atgggatgtt      1620
     gatacgaatt taaagcccgg tgaagaagac tcaattacaa gccccgagaa aagatggatt      1680
     ggcgacacca atggtcggag gggaagcgca ttatggcaca tgcgtaatgt gaaaactccc      1740
     attctgattc ttcatgggga ggacgacgag cgtgtgcctt tagaacaggc catcgcgttc      1800
     tatcgcgcat gtgtccacaa caatgtacct gttgagatgg tgacttatcc tcgagaaggg      1860
     cattttattg ttgaaaggag acatctcatt gatatgtggg agcggatgag gacgttttgt      1920
     tatcggaact tacagtga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page