(data stored in SCRATCH zone)

EMBL: AM269952.PE46

AM269952.PE46        Location/Qualifiers
FT   CDS_pept        complement(join(111140..111629,111721..112112,
FT                   112169..112309,112374..112535))
FT                   /locus_tag="An01g01220"
FT                   /note="Function: M. grisea Pth11p can activate appressorium
FT                   differentiation in response to inductive surface cues and
FT                   repress differentiation on poorly inductive surfaces using
FT                   multiple signaling pathways to mediate differentiation."
FT                   /note="Remark: the adjacent genomic region contains another
FT                   predicted A. niger protein with similarity to M. grisea
FT                   PTH11."
FT                   /note="Similarity: similarity is from the N-terminal region
FT                   of the predicted A. niger protein to the N-terminal region
FT                   of M. grisea PTH11, which is 200 aa longer."
FT                   /note="Title: similarity to surface recognition protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /note="localisation:plasma membrane"
FT                   /note="See PMID 10521529"
FT                   /db_xref="GOA:A2Q7M1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M1"
FT                   /protein_id="CAK43497.1"
FT                   /translation="MEYTLPLVGHSLAIFIVSAVTVGLAIICVSLRCFVRLYILRAFGW
FT                   DDALVVTALALFIALGVLCMMGPEAGIGHTLADFESFSLKSGNPMDSLHALQYAMIYWW
FT                   LGQMLYLWASAVAKVAIALALLRLAVRPLHRFILWAVIGTVICIGLVFWLILLLDCRPI
FT                   GYFWGQINPLNSGTCLPTNILLIIAYIYSSLSIVCDFTLGIFPAALIWGLHMSPRTKVA
FT                   LGAILGLGAVTTPTRTSSVSFSTTPSQAGLADNADSTYQIAIWSVMETGLAIIAGSLIT
FT                   LRPLFRWFLDGSSSYRLDKPHYVRQEDYVAGGYALSSSMPNRSITQDNLKYWRPDLSAE
FT                   NPRAHGVITSVSTPLGRGHLTGSQESLTGNLPGREVRQKHQVSVLRTFTVEDKV"
     atggagtata ccctgccttt agttggccac agcctggcga ttttcatcgt ctcggctgtg        60
     acagttgggt tagcaatcat ttgtgtctcg ctgcggtgct ttgtgcgtct gtacattctg       120
     cgtgcgtttg ggtgggatga cgcgcttgtg gtgacggcgc tggcgctatt tatagcattg       180
     ggcgtgctgt gcatgatggg accggaagct gggattggtc acacactcgc ggacttcgag       240
     tcgttcagtc tgaagagtgg gaatcccatg gatagtctgc acgcattgca gtatgcgatg       300
     atatactggt ggcttggaca aatgctctac ctgtgggcgt cagccgtcgc caaagtagcc       360
     attgcccttg ctctccttcg actggccgtt cgcccactgc accgcttcat tctctgggcc       420
     gtcataggaa ccgtgatatg tattggcctc gtcttctggc ttattctgtt gctcgattgt       480
     cggccaatcg ggtacttttg gggccagatc aacccactca attcgggcac gtgcttgcca       540
     actaatatcc tcctcatcat cgcatacatc tatagttcgc tttccattgt ctgtgacttt       600
     acgcttggga tcttcccagc ggcgttgatc tgggggctgc acatgtcgcc gcgcacaaag       660
     gtggcgttgg gcgcgatcct cgggctggga gcagtcacta cgccgacgcg gacttcctct       720
     gtaagcttct ccacgactcc atcacaagca ggattggctg acaatgcaga ctcgacttac       780
     caaatcgcca tctggtccgt catggaaacc ggcctcgcca tcatcgccgg cagcctcatt       840
     acgctccgcc cgctcttccg ctggttcctc gatggcagtt cgtcataccg cttggataag       900
     ccacattacg tgcggcagga agactacgtc gcgggcggtt atgcattgtc aagctccatg       960
     ccgaatagat cgatcaccca agacaatctg aagtactgga ggccggatct gtccgcggag      1020
     aacccgcgcg cgcacggggt tatcacgtct gtgtcgacac cgctggggag gggccactta      1080
     accggtagtc aagagagcct gacgggaaac ctgcccggca gagaggtgcg gcaaaagcat      1140
     caggttagcg ttcttcgaac gtttacggtg gaggataagg tgtga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page