(data stored in SCRATCH zone)

EMBL: AM269952.PE47

AM269952.PE47        Location/Qualifiers
FT   CDS_pept        join(114311..114643,114697..115041)
FT                   /locus_tag="An01g01230"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC869.06c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q7M2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M2"
FT                   /inference="profile:COGS:COG2846"
FT                   /inference="profile:COGS:COG5592"
FT                   /inference="profile:PFAM:PF03794"
FT                   /inference="similar to AA sequence:PIR:T39117"
FT                   /protein_id="CAK43498.1"
FT                   /translation="MTSRYILNSSRPILRPLLSIPKQHRSISQSPIIMAPRISEAIKTD
FT                   HREIEDYYNKILNSATEKEKIEWQNQFTWELARHSIAEELVVYPQFEKSIPDGRAMADK
FT                   DRKEHQSVKEQLKKFQNMKPADPEFESTIRALMKDLSEHIKEEESQDLPKLEDAVSAEE
FT                   SEKLSKSFGRTKMFVPSRSHPSAPDKPPFETAIGLMTAPIDHLADLFRKWPHTSGMPNP
FT                   STK"
     atgactagcc gctatattct caactcttcc cgccctatcc ttaggcctct actatctatc        60
     ccaaaacaac accgctccat atcccaatcc cctatcatca tggcacctcg tatatccgaa       120
     gcgatcaaga ccgatcaccg cgagatcgag gactactaca acaagatcct gaactctgct       180
     accgagaaag agaaaatcga atggcaaaac caatttactt gggaattagc ccgtcattcg       240
     atcgccgagg agctggtcgt ctacccccag ttcgagaagt ccatccccga cggccgggcc       300
     atggcagata aggaccggaa ggagcatcaa tcggttaaag aacagctgaa aaaattccaa       360
     aacatgaaac ccgcggaccc ggagttcgag tctactatca gggcgttgat gaaggacctc       420
     tccgagcaca tcaaggaaga agagagtcaa gatctgccga agctggaaga cgccgtgtcg       480
     gcggaggaaa gcgagaagct ttcgaagtct tttggtagga cgaagatgtt tgtgccctcg       540
     cggtcccatc ctagtgcgcc tgataagccg ccttttgaga ctgctatcgg tttgatgact       600
     gctccgattg atcatttggc tgatttgttt cgcaaatggc cgcatacttc ggggatgccg       660
     aatccttcta cgaagtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page