(data stored in SCRATCH zone)

EMBL: AM269952.PE48

AM269952.PE48        Location/Qualifiers
FT   CDS_pept        complement(115304..>115861)
FT                   /locus_tag="An01g01240"
FT                   /note="Function: C. carbonum TOXA likely encodes an
FT                   HC-toxin efflux pump which contributes to self-protection
FT                   against HC-toxin and/or the secretion of HC-toxin into the
FT                   extracellular milieu."
FT                   /note="Remark: ORF 5'truncated due to end of contig."
FT                   /note="Remark: the function of C. carbonum TOXA is
FT                   indicated by its sequence similarity to the major
FT                   facilitator superfamily and the impossibility to mutate
FT                   TOXA in HC-toxin producing strains."
FT                   /note="Similarity: C. carbonum TOXA is a member of the
FT                   major facilitator superfamily."
FT                   /note="Title: similarity to HC-toxin efflux pump TOXA
FT                   -Cochliobolus carbonum [truncated ORF]"
FT                   /note="localisation:plasma membrane"
FT                   /note="See PMID 8704997"
FT                   /db_xref="GOA:A2Q7M3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M3"
FT                   /inference="profile:COGS:COG0477"
FT                   /protein_id="CAK43499.1"
FT                   /translation="ISGMLLTTLGYGLFIDLPSTKSWPRIILFQIVAGLGIGPNFQATL
FT                   IALQANTTPAELSRGTGTFSFVRQLAAAISVVVGSVLYARAVSGQRGALAAVLGETVAQ
FT                   EIVEASTAAAAIVETLPVGEDRTVVFHALTAALRWVWVFYTAVAGVGFLLSLCLRDLRL
FT                   GDAHRMAPGQESEELEMERGTT"
     atctcaggca tgctcctcac caccctgggc tatggcctat ttatcgacct cccctccacc        60
     aagtcctggc cgcggattat ccttttccag atcgtcgccg gactcggcat cgggcctaac       120
     ttccaggcta ccctgattgc cctgcaagcc aacaccaccc ccgccgaatt aagtcgcggc       180
     accggaacct tttcgttcgt gcgccagctg gccgctgcta tctctgtcgt cgtcgggtct       240
     gtgctgtacg cgcgcgctgt aagcgggcaa cggggcgctc tggctgccgt actgggcgag       300
     acggtcgcgc aggagatcgt ggaggcgtcg acagctgcag cggcgattgt ggagacattg       360
     cctgtcggcg aggatcggac ggtggtgttt catgcgttga cggctgcgtt gcgctgggtg       420
     tgggtgtttt atactgctgt cgcgggggtc ggattccttc tcagtctgtg tttgcgtgat       480
     ttacggttgg gcgatgcgca ccgaatggct cctggtcagg agagtgagga attagagatg       540
     gagaggggga ctacatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page