(data stored in SCRATCH zone)

EMBL: AM269952.PE6

AM269952.PE6         Location/Qualifiers
FT   CDS_pept        complement(join(10502..10569,10624..10765))
FT                   /locus_tag="An01g00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7I1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I1"
FT                   /protein_id="CAK43457.1"
FT                   /translation="MMHLMFAIAQLPTDLAALNDRYFHHTTLRKPSDNTTDEKRGIVST
FT                   RQRQLPEQSDLFKPQANIRIVFGA"
     atgatgcatt tgatgttcgc tattgctcag ctgcctacag acttagcagc actcaatgat        60
     agatattttc atcatactac actgcgtaag ccctcggata atactaccga cgagaagcgt       120
     ggcattgttt ctacacggca aaggcagtta cctgagcaat cggatctttt taagccacag       180
     gctaatatca ggatagtgtt tggcgcctag                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page