(data stored in SCRATCH zone)

EMBL: AM269952.PE7

AM269952.PE7         Location/Qualifiers
FT   CDS_pept        complement(join(10928..11010,11079..11919))
FT                   /locus_tag="An01g00800"
FT                   /note="Title: similarity to hypothetical protein AAO51454.1
FT                   - Dictyostelium discoideum"
FT                   /db_xref="GOA:A2Q7I2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I2"
FT                   /protein_id="CAK43458.1"
FT                   /translation="MSSDQTASYLPTPNNVQPTKGPRYKRKYLVSILLGTISLVAIIVA
FT                   VVCLSVLLPKRLKHDNNHDGGNHNTGVSTTQGNDTHSLDPDGSTYNGGGVQNGTGTHTT
FT                   GATPTGDVPHQPSATSNGEDSQRPNGVVNVTDTQPVQGGSQSQDGECHVVSKVSYTFYG
FT                   YPDNDPPGSDISEDCGRGMAAGGIGTHENPLTFATAPGEFDRCEVVYSPYLQKYLINED
FT                   YCEQCTKDWKSHIWHVDVWLGGNSTTYGTEQLKCENSLTSAEESQVVIKNPSSNLPVDL
FT                   TSFYLGGNSVCSLDHIYPEYDTNDYC"
     atgtcttccg atcaaactgc cagctatctc ccaactccaa ataatgtgca gccaaccaaa        60
     ggtccaagat acaaacgcaa atacctggtg tcgatccttc tcggaaccat ttccctcgtc       120
     gctataattg ttgcagttgt ctgtctctca gtcttgctcc ctaaaaggct taagcacgac       180
     aataaccacg acggaggcaa ccataatacc ggagtaagta ctactcaagg aaacgacacc       240
     cattccttgg atcccgatgg aagcacttac aacggaggcg gtgttcaaaa tggaactggc       300
     actcatacca cgggtgccac tccgaccggt gatgttccac atcagccaag tgctacttct       360
     aatggggagg actctcagcg gccaaatgga gttgtcaatg taactgacac acagcccgta       420
     cagggaggaa gccagtccca ggatggggaa tgccatgttg tcagcaaagt atcttacacc       480
     ttctatggat atcccgacaa tgaccctccg ggttcagata tctccgaaga ctgtggtcgc       540
     ggcatggctg ctggcggtat cggcacccac gagaatccgc tgactttcgc cacggcgcct       600
     ggcgaattcg acagatgcga ggtcgtctac tcaccatacc tacagaaata tctgatcaac       660
     gaagactatt gcgaacagtg cacaaaagat tggaagagcc atatttggca cgtcgacgta       720
     tggttggggg gaaactcaac cacttacggc acagagcagc tgaaatgcga gaatagcctg       780
     acttcggccg aagaaagcca ggtcgtgatc aaaaacccaa gcagcaatct gcctgttgat       840
     cttacctcgt tctatctggg gggcaattca gtttgcagcc tcgatcacat ttatccagaa       900
     tacgatacaa atgactattg ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page