(data stored in SCRATCH zone)

EMBL: AM269952.PE8

AM269952.PE8         Location/Qualifiers
FT   CDS_pept        complement(join(12834..12867,12920..13269))
FT                   /locus_tag="An01g00810"
FT                   /note="Title: weak similarity to androgen receptor A hARa
FT                   -Homo sapiens"
FT                   /db_xref="GOA:A2Q7I3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I3"
FT                   /protein_id="CAK43459.1"
FT                   /translation="MADDPDVSQWQFSTTWLYFPCTEEYQNRAEQFQRAIENIDSLTYA
FT                   IYHYNPAIPPTMRGVLLAVYHPLDYGTASILAIARGDLVSYRNAAAGQPGGMGPSQSTI
FT                   YLSLNEDDDMDTSEDAMMSTDIQ"
     atggctgatg atcctgacgt ttctcagtgg cagtttagta cgacgtggct atatttcccg        60
     tgtacagaag agtaccagaa ccgagccgaa cagtttcaga gagctattga gaacatagat       120
     agcttgacct acgcgatcta ccactacaat ccagccattc ctcctactat gcggggtgtt       180
     ctgcttgcgg tctatcaccc actggattat ggtacagctt ctatcctggc cattgcacgc       240
     ggcgacttgg tcagctatcg aaatgccgct gctggacaac ccggggggat gggacccagc       300
     cagtcgacca tatatctctc gcttaatgaa gatgatgata tggatactag cgaagacgca       360
     atgatgagca cggatattca gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page