(data stored in SCRATCH zone)

EMBL: AM269952.PE9

AM269952.PE9         Location/Qualifiers
FT   CDS_pept        join(14764..14840,14902..15344,15407..16044,16100..16534)
FT                   /locus_tag="An01g00820"
FT                   /note="Function: The QUTD gene encodes an essential
FT                   component of a permease required for transport of quinate
FT                   ion into mycelium."
FT                   /note="Localization: The QUTD gene has been located within
FT                   the cloned QUT gene cluster of A. nidulans."
FT                   /note="Similarity: The QutD gene shows strong homology with
FT                   the N. crassa QA-Y gene."
FT                   /note="Title: strong similarity to quinate transport
FT                   protein qutD - Aspergillus nidulans"
FT                   /note="See PMID 2835177"
FT                   /note="See PMID 2976880"
FT                   /db_xref="GOA:A2Q7I4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I4"
FT                   /inference="profile:COGS:COG0477"
FT                   /inference="profile:PFAM:PF00083"
FT                   /inference="similar to AA sequence:PIR:S08498"
FT                   /protein_id="CAK43460.1"
FT                   /translation="MALWKFPKLNSTLGTLRAYHLAAIIFVSSFLAGYDSGIAGGILSY
FT                   KTFEDDFRYTSAHESKVSSLTVGLEQLGSFVASLFAYYLTDKFGRKWVIIGSTAVFCIG
FT                   VIIQVINTHSLGAWYAGRIIAGIGMGGQSVVVPMYSAEMTPKEIRGRCGSFYQWLYTWG
FT                   ILAAYWIDYVPSASISKTSREWQIPVGLQLVSGGIMVIGACTLPESVRWLLSQNRADEA
FT                   WKSLTWIRGDEGEKTIEEFKETQLGLKAEKAAKENFSLRELWEPANRLRFCVGPMLFVF
FT                   QNATGSSALAVFAPEYFKLLVGSGGNRDLLLTGLFGAVKFIACTFFILFLAERFGRRIL
FT                   LTGGSVFMAICMLITALIVKCIPTESNTSVTSAGRATVAMLYLDIMVYNCSWGPVPWAY
FT                   VPEIFPTRIRALGLACSMLAHWATSFCFSFASPYMIDNIGANTFLLFMAFDIAAALFCF
FT                   VFVRETRGQNLEVAAGTEWDVVEKSADDLAASEKGEVDIDKPSEIGVAPAAGKQLEVVA
FT                   VHDTYGSNFKRRS"
     atggcgcttt ggaagtttcc caagctcaac tccacgctag ggacgctgag ggcctatcac        60
     ttggccgcaa tcatattcgt ctcttcgttc ttggcaggtt atgactccgg cattgcgggc       120
     ggaattttga gctacaagac cttcgaggat gactttcgtt atactagcgc ccacgagtct       180
     aaggtctctt ccttaacggt cggcctggag cagctggggt ccttcgtcgc atccctcttt       240
     gcttattatc tcaccgacaa gtttgggcgc aaatgggtta tcatcggctc aactgctgta       300
     ttctgcatcg gagtgatcat tcaggtcatc aatacccact cgctcggtgc atggtatgca       360
     ggccgcatta tcgctggtat cggtatggga ggtcaaagtg ttgttgttcc catgtactcc       420
     gccgagatga cgccgaagga aatcagaggg cgatgcggtt ccttctatca atggctatac       480
     acatggggta tccttgcggc ttattggata gactatgtac cgagtgcaag tatatcgaaa       540
     acatcacgcg aatggcagat ccccgtgggt ctccagctgg tctcgggagg aatcatggta       600
     atcggagcat gtacactgcc tgagtccgta cgttggctac taagccaaaa cagagccgac       660
     gaagcttgga agtccttgac ctggattcgc ggtgacgaag gggagaaaac catcgaagag       720
     tttaaagaga cacagctcgg cttgaaggca gaaaaggcag cgaaagagaa cttttctctt       780
     cgtgagctgt gggaaccggc taatcgcctg cgtttctgcg tcgggcctat gctttttgtt       840
     tttcaaaacg caacgggaag cagtgccctt gctgtcttcg caccagaata cttcaagctc       900
     cttgtcggaa gcggaggtaa ccgtgatctt ctgctcactg gtctctttgg tgctgtgaag       960
     ttcattgctt gcacattctt cattctcttc ctcgcagaac gattcggccg tcggattctg      1020
     ctcacaggcg gatcagtctt catggcgatt tgtatgttga ttaccgcttt gattgtcaag      1080
     tgtatcccga ccgagtcgaa tacgtcagtc acatctgccg gccgagccac ggtcgccatg      1140
     ctctacttgg atatcatggt ttataattgc tcatggggtc cggtcccttg ggcatatgtg      1200
     ccggagattt tccccacgcg cattcgagcc ctgggactag catgcagtat gttggctcac      1260
     tgggcgacat cattctgttt ttcctttgct agtccctaca tgattgacaa catcggagca      1320
     aacaccttcc tgttgttcat ggctttcgat attgccgctg cactcttctg ctttgtcttt      1380
     gtccgtgaaa ctcgtggtca gaatctggag gttgccgcag ggaccgagtg ggacgtggtt      1440
     gaaaagtccg ctgatgatct ggcggcaagc gagaaaggcg aagtcgacat tgataaacct      1500
     tcagagattg gagtggcacc tgcggctggc aagcaactgg aggtcgttgc ggtgcacgat      1560
     acttacggct cgaattttaa gcggcggtcg taa                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page