(data stored in SCRATCH zone)

EMBL: AM269952.XYNB

AM269952.XYNB        Location/Qualifiers
FT   CDS_pept        complement(join(9153..9552,9621..9898))
FT                   /gene="xynB"
FT                   /locus_tag="An01g00780"
FT                   /product="endo-1,4-xylanase xynB-Aspergillus niger"
FT                   /note="Catalytic activity: Endohydrolysis of
FT                   1,4-beta-d-xylosidic linkages in xylans."
FT                   /note="Gene-ID: xynB"
FT                   /note="Pathway: Xylan degradation."
FT                   /note="Similarity: Belongs to cellulase family g (family 11
FT                   of glycosyl hydrolases)."
FT                   /db_xref="GOA:A2Q7I0"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7I0"
FT                   /inference="profile:PFAM:PF00457"
FT                   /inference="similar to AA sequence:SWISSPROT:XYN2.ASPNG"
FT                   /protein_id="CAK43456.1"
FT                   /translation="MLTKNLLLCFAAAKAALAVPHDSVAQRSDALHMLSERSTPSSTGE
FT                   NNGFYYSFWTDGGGDVTYTNGDAGAYTVEWSNVGNFVGGKGWNPGSAQDITYSGTFTPS
FT                   GNGYLSVYGWTTDPLIEYYIVESYGDYNPGSGGTYKGTVTSDGSVYDIYTATRTNAASI
FT                   QGTATFTQYWSVRQNKRVGGTVTTSNHFNAWAKLGMNLGTHNYQIVATEGYQSSGSSSI
FT                   TVQ"
     atgctcacca agaaccttct cctctgcttt gccgcggcta aggctgctct ggctgttccc        60
     cacgactctg tcgcccagcg ttcggatgcc ttgcacatgc tctctgagcg ctcgaccccg       120
     agctcgaccg gcgagaacaa cggcttctac tactccttct ggaccgacgg cggtggcgac       180
     gtgacctaca ccaacggaga tgctggtgcc tacactgttg agtggtccaa cgtgggcaac       240
     tttgtcggtg gaaagggctg gaaccccgga agtgcgcagg acatcaccta cagcggcacc       300
     ttcaccccta gcggcaacgg ctatctctcc gtctatggct ggaccactga ccccctgatc       360
     gagtactaca tcgtcgagtc ctacggcgac tacaaccccg gcagtggagg cacatacaag       420
     ggcaccgtca cctcggacgg atccgtttac gatatctaca cggctacccg taccaatgct       480
     gcttccattc agggaaccgc taccttcact cagtactggt ccgtccgcca gaacaagaga       540
     gttggcggaa ctgttaccac ctccaaccac ttcaatgctt gggctaagct gggaatgaac       600
     ctgggtactc acaactacca gatcgtggct accgagggtt accagagcag tggatcttcg       660
     tccatcactg ttcagtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page