(data stored in ACNUC7421 zone)

EMBL: AM269962.PE1

AM269962.PE1         Location/Qualifiers
FT   CDS_pept        complement(join(<1..437,505..1048,1112..1257,1328..1628))
FT                   /locus_tag="An01g04210"
FT                   /note="Function: SutB of P. chrysogenum is the major
FT                   sulfate permease involved in sulfate uptake by P.
FT                   chrysogenum."
FT                   /note="Function: in industrial fermentations, P.
FT                   chrysogenum uses sulfate as the source of sulfur for the
FT                   biosynthesis of penicillin."
FT                   /note="Phenotype: disruption of P. chrysogenum sutB
FT                   resulted in a loss of sulfate uptake ability."
FT                   /note="Remark: the C-terminal half of the homolog to SutB
FT                   of P. chrysogenum is located on An01g04200."
FT                   /note="Remark: the ORF is C-terminally truncated due to
FT                   contig border."
FT                   /note="Title: strong similarity to sulfate permease SutB
FT                   -Penicillium chrysogenum [truncated ORF]"
FT                   /db_xref="GOA:A2Q8G0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G0"
FT                   /inference="profile:COGS:COG0659"
FT                   /inference="profile:PFAM:PF00916"
FT                   /inference="similar to AA sequence:UniProtKB:AF163974.1"
FT                   /protein_id="CAK36957.1"
FT                   /translation="MSQDLMTKTGHGLAKVLGIKLPYRDPLGAHSDPVTRGESTFSYGT
FT                   VDTYSYLEPEPTTAEWLKEICPTWHDVLMYFYRLFPFLSWITKYNLQWFFGDLVAGVTV
FT                   GAVVVPQGMAYAKLAELPVQYGLYSSFMGVLVYWFFATSKDITIGPVAVMSTLVGTIVL
FT                   QAQKEIPDVPGHIVASCLAIICGAIVCALGLLRLGFIVDFIPLPAISAFMTGSALNIAA
FT                   GQVKKLLGESADFSTRGSTYMIIINSLKYLPTAGIDAALGVTALAMLYIIRSGCNYGAR
FT                   KYPRHAKVWFFASTLRTVFVILFYTMISAAVNLHRKDNPMFDLLGSVPRGFQNAAVPVV
FT                   NARIIKVFASQLPACVIVLLIEHIAISKSFGRVNNYTIEPSQELVGIGVTNLLGPFLGA
FT                   YPATGSFSRTAIKSKAGVRTPLAGCITAIVVLLAIYALTAVFFYIPQAALSGVIIHAVG
FT                   DLITPPNTVYQLLARTRP"
     atgtcgcaag acctcatgac caagactggc cacggcctgg ccaaagtcct gggtatcaaa        60
     ttgccttatc gggatcccct tggagctcac tccgaccccg tcactcgtgg cgaatcgacc       120
     ttctcatacg gcaccgttga tacatactct tatttggagc cggaaccgac cactgccgaa       180
     tggctcaaag aaatctgtcc aacctggcat gatgtcctta tgtactttta cagactgttc       240
     cccttcctct catggatcac gaagtataac ctgcaatggt tcttcggtga tcttgttgct       300
     ggtgtgactg tcggtgctgt cgttgtccct cagggaatgg cctatgccaa actcgccgaa       360
     ctaccagtgc agtatggtct ctactcatcg ttcatgggtg tactggttta ttggttcttt       420
     gccacttcca aggatatcac tatcgggccc gtcgctgtaa tgtccacgct ggtcggaacg       480
     attgtgcttc aggctcagaa agagatcccg gatgtcccag ggcatatcgt tgcatcttgc       540
     ctggctatca tctgtggtgc catcgtctgt gccctcggtc tccttcggct cggcttcatc       600
     gttgacttca ttccccttcc tgcaatttcg gcattcatga cgggatccgc tctaaacatc       660
     gctgccggtc aagtcaagaa gctgctggga gaatcggcag atttctccac cagaggctcg       720
     acctatatga tcataatcaa ctcgctgaag taccttccta ctgcgggtat tgatgctgcc       780
     cttggtgtca cagccttggc catgctgtac attatccgtt cgggttgcaa ttatggtgct       840
     cgaaagtacc ctcgccacgc taaagtgtgg ttcttcgcgt cgacgctgcg aactgtcttt       900
     gtcatcctgt tctacaccat gatcagtgca gctgtcaacc ttcaccgcaa ggataacccg       960
     atgtttgatc ttctgggcag tgtcccaaga ggtttccaaa atgcggctgt tcctgttgtc      1020
     aacgccagga tcatcaaggt tttcgccagt cagctccctg cttgcgtcat cgtcctcctt      1080
     atcgagcaca tcgccatttc caagtcattc ggccgtgtca acaactatac catcgagccg      1140
     tcccaagaat tggtcggtat tggtgtgacc aaccttcttg gtcctttcct gggcgcgtac      1200
     cctgctaccg gatccttttc ccggaccgcc atcaagtcga aggcgggtgt tcgtactccc      1260
     ttggccggct gtatcaccgc cattgttgtg ttgctcgcca tctacgccct gaccgccgtc      1320
     ttcttctata tcccccaagc tgccctttct ggtgttatca ttcacgctgt cggcgatttg      1380
     atcacgcccc ccaacactgt gtatcaatta ctggcgcgta ctcgtccc                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page