(data stored in ACNUC7421 zone)

EMBL: AM269962.PE10

AM269962.PE10        Location/Qualifiers
FT   CDS_pept        complement(join(20206..20253,20308..21813))
FT                   /locus_tag="An01g04310"
FT                   /note="Function: the S. pombe homolog Mex67p participates
FT                   at various common steps with Rae1p export complexes in
FT                   promoting the nuclear cytoplasmic export of mRNA."
FT                   /note="Similarity: S. pombe Mex67p has similarity to the
FT                   human mRNA export factor Tap."
FT                   /note="Title: strong similarity to mRNA export factor
FT                   mex67p - Schizosaccharomyces pombe"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8G9"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR030217"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G9"
FT                   /inference="profile:PFAM:PF03943"
FT                   /inference="similar to AA sequence:PIR:T43683"
FT                   /protein_id="CAK36966.1"
FT                   /translation="MLQLNGFSFAGAPLTTEKYDPSTGGLLDQPMLSAMAQNGGTSSAA
FT                   ETKAKMTTILGKRYTQQTKLLDLSKLGTDPDLLAMGIFGSTSTESKFFPALMKVWELNF
FT                   DNATARREAVESVSLAHNQLANITAVTALASTIPDLKNLDLSNNEFKDAQSLIGWRWKF
FT                   RNLEFLDLSNTPFSADPTFKDTMLKWYPKLRFLNNVEVRTAEEIAAQKKTPIPVQPPHF
FT                   QDDSQIAENFVRAFFAGYDNDRSGILNSVYDNHTTFTLNVNTSAPRAQQTETAPWDAYI
FT                   KKSRNLLKISHLPARMSRVYTGAEKIRELWTSLPATRHPDIATRPEEWLIECYPIPGLP
FT                   DISGQSSTGVGGLLIMVHGKFDEINGAKVETRSFDRTFIIGPGGGMGGIRVVSDILCLR
FT                   AYGGHEAWIPEVPPAVPQAAPPAAPAPAPAAPAAPAALPVAIPGAPEGYGMPAPGKADA
FT                   QVQQEQLVLQMSSNTRMTLQYSEMALSGNGWNMEAALKNFEELKAQGTLPPEAFLPAAV
FT                   "
     atgcttcagc tcaatgggtt tagttttgca ggtgcccctc ttaccaccga aaagtatgac        60
     ccgtctactg gtgggttgct ggaccagcct atgctgtctg ctatggcaca aaatggcggc       120
     acatcctctg ctgccgagac caaggcgaaa atgacgacaa ttctcggcaa gcgctacacc       180
     cagcagacaa aattactcga tctttcgaaa ttgggaaccg atccggatct cttggctatg       240
     ggaatctttg gcagcacatc caccgagtcg aaattcttcc cggcactgat gaaggtttgg       300
     gagctgaatt tcgacaatgc cactgcgcgt cgagaggcag tggagagtgt cagtctcgct       360
     cataatcagc ttgccaacat cacagctgtg acggcactag catcgacaat tccagacctg       420
     aaaaatctgg atctttccaa caatgaattc aaagatgcgc aatccttgat tggatggcgc       480
     tggaaattcc gcaatctcga gtttctcgat ctctcaaaca ctccgttcag cgccgaccct       540
     actttcaagg ataccatgtt gaagtggtat cccaagctcc ggttcctgaa caatgtcgaa       600
     gtccgtaccg cagaagaaat agcggcgcag aagaagacgc cgattcctgt gcaaccaccg       660
     cacttccagg acgactctca gatcgcagag aactttgtta gggctttctt cgcgggctac       720
     gacaacgacc gaagcggcat tctcaacagt gtctacgaca accacacgac gttcactctc       780
     aatgtgaata catcggctcc cagggcccaa caaacagaaa cagcgccctg ggatgcgtat       840
     atcaagaaaa gcagaaacct tctcaagatc agccatcttc ctgcacgcat gtctagggta       900
     tacaccggtg cggagaaaat ccgcgagttg tggactagtc ttcccgcgac tagacatcct       960
     gacattgcga cgcgcccgga agaatggctt atcgagtgct accctatccc gggtcttcct      1020
     gatatttccg ggcagagctc cacgggtgtt ggtggacttc tcatcatggt gcacgggaag      1080
     ttcgacgaga ttaatggggc caaggttgaa actcgcagtt tcgataggac attcatcatc      1140
     gggcccggtg gtggtatggg cggaatcagg gtcgtcagtg atattctctg cttgcgagcc      1200
     tatggtggac acgaggcatg gattcctgag gttccaccag ccgtacccca agctgcacct      1260
     ccagctgcac cagcaccagc acccgcagcc cctgcagccc ctgcggcact accagtagcc      1320
     attccgggtg ctcccgaagg ctacggcatg ccagcgcctg gaaaagcaga cgcacaagtc      1380
     cagcaagagc agctagtact tcagatgagc tctaatactc gaatgaccct ccagtactct      1440
     gagatggctt tgtctggaaa cggctggaat atggaggctg cactgaagaa ctttgaggaa      1500
     cttaaggcgc agggaacatt gcctccggag gcttttctac ccgcagcagt gtag            1554
//

If you have problems or comments...

PBIL Back to PBIL home page