(data stored in ACNUC7421 zone)

EMBL: AM269962.PE11

AM269962.PE11        Location/Qualifiers
FT   CDS_pept        join(23354..23546,23614..23794,23877..24428,24507..24801)
FT                   /locus_tag="An01g04320"
FT                   /note="Complex: part of the Erv41p-Erv46p subcomplex
FT                   associated with the COPII vesicle coat."
FT                   /note="Function: S. cerevisiae Erv46p is involved in ER to
FT                   Golgi vesicle transport."
FT                   /note="Remark: a splice site upstream of the start codon
FT                   was detected."
FT                   /note="Remark: alternative gene names for the S. cerevisiae
FT                   homolog ERV46 are FUN9 and YAL042W."
FT                   /note="Title: strong similarity to COPII vesicle coat
FT                   component protein Erv46 - Saccharomyces cerevisiae"
FT                   /note="intracellular transport vesicles"
FT                   /db_xref="GOA:A2Q8H0"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H0"
FT                   /inference="similar to AA sequence:PIR:S51977"
FT                   /protein_id="CAK36967.1"
FT                   /translation="MPAKSRFTRLDAFAKTVEDARVRTTSGGVITIASLLVILWLVWGE
FT                   WADYRRVVVMPELVVDKSRGEKMEIHLNVTFPRLPCELLTLDVMDVSGEQQTGVVHGIN
FT                   KVRLTSAAEGGRVIDVKALELAKHLDPDYCGECYGATAPAGASKPGCCNTCDEVREAYA
FT                   QQQWAFGKGENVEQCELEGYAERIDAQRREGCRLEGVLRVNKVVGNFHIAPGRSFTSGN
FT                   MHVHDLANFFDADLPDAEKHTMTHEIHQLRFGPQLPDELSDRWQWTDHHHTNPLDGTKQ
FT                   ETNEPGYNYMYFVKVVSTSYLPLGWDPLIETHQYSVTSHKRSLMGGDASDEGHKERLHA
FT                   ANGIPGVFVNYDISPMKVINREARPKTFTGFLTGVCAIIGGTLTVAAALDRGLYEGVSR
FT                   MKKLHSN"
     atgccggcga aatcgcgatt cacaaggcta gatgcctttg ctaaaacagt ggaggatgcg        60
     cgcgtccgta ccacatccgg aggtgtcatc accatagcct cgttgctggt catcctgtgg       120
     cttgtgtggg gtgaatgggc ggattacagg cgggtggttg ttatgcccga attggtggtt       180
     gataaatcaa gaggcgagaa gatggagatt cacctaaacg tgaccttccc tcgtcttccc       240
     tgtgagctcc tgactctgga cgttatggat gtctctggcg agcaacagac cggtgttgtc       300
     cacggtatca acaaggtgcg ccttacttct gccgcagaag gaggccgcgt catcgacgtc       360
     aaggccctgg agcttgccaa gcacctcgac cccgattact gtggtgaatg ttacggcgcg       420
     actgctcccg ccggtgcaag caaacctgga tgctgcaaca cctgcgacga agttcgtgag       480
     gcctacgcac agcagcaatg ggcattcgga aagggcgaaa acgttgagca gtgtgagctt       540
     gagggctacg cggagcgcat cgatgcgcaa cgccgcgagg gctgccgcct tgagggtgtc       600
     ctccgtgtga acaaggtggt cggcaacttc cacattgctc cgggtcgcag tttcaccagc       660
     ggaaacatgc acgtccatga cctcgcgaac ttcttcgacg ccgatctacc tgatgctgag       720
     aaacacacca tgactcacga gatccaccag ctgcggttcg gacctcagct tcctgacgag       780
     ctctctgatc gctggcaatg gactgaccac caccacacca accctctgga cggtaccaag       840
     caggagacaa acgagcccgg atacaactac atgtacttcg tgaaggtggt gtcgacctct       900
     tacctccccc tgggctggga tccgctcatc gaaacccacc aatactctgt gacctcgcac       960
     aagcgctcgc tgatgggcgg agacgcctcc gacgagggcc acaaggagcg tctgcacgct      1020
     gccaacggca ttccaggcgt cttcgtcaac tacgacatct cccccatgaa agtcatcaac      1080
     cgcgaggccc gtcccaagac cttcactggt ttcttgactg gggtgtgcgc catcatcggt      1140
     ggtaccctga ccgtcgcggc agccctagac cgtggtctct acgagggtgt cagtaggatg      1200
     aagaagctcc actcgaactg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page