(data stored in ACNUC7421 zone)

EMBL: AM269962.PE12

AM269962.PE12        Location/Qualifiers
FT   CDS_pept        complement(join(25857..28850,28915..29072,29132..29482,
FT                   29560..29575))
FT                   /locus_tag="An01g04330"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YLR187w - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q8H1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H1"
FT                   /inference="profile:PFAM:PF00169"
FT                   /inference="similar to AA sequence:PIR:S51432"
FT                   /protein_id="CAK36968.1"
FT                   /translation="MGRSRVLSLMSVFGGSSRKDNLSQHHRTSSASLTLNNPPRRVDTP
FT                   SSDTPSPLDASPITGTPHVERRVTSRPESTLFSHNPPLLEFSQDTPPELQPIFGYLNSH
FT                   ANKLYHEGYFLKLNDLDIHGRPCADRQWVECYAQLVGTALSLWDAAALDAAEESEDVCP
FT                   TFINLADASIKMLETLPTRNQGAQSLKNILSICSAGQNRYLLHFNSFHSLTQWTAAIRL
FT                   ALFEHTSLYEAYTGSIIAGKGKGLNSIRTILDRHRYKHEDWARVRFGAGTPWRRCWFVI
FT                   TPPNEKEFQKAQKSIKKKSAYDRAPRLITGDIKFYDTKKTKKAKPIATITDAYAAYAIY
FT                   PQSRALIEQSTLVKIEGKITVHGQTESTTDGFVFVMPEVHPAVSGFEMMLRFLVPTFDT
FT                   FNLYGRPTRLIAATNHIKSIMFAFPNQRRYGYLDILDISSLMQTPGSQDWNEAEWRQQL
FT                   KEATARRMAAAGSRTSSISASKPRFRATMPNRQPNGRTMTHQRNCTSPVNQLDSNQSND
FT                   AVAPGAPRDASISPIHHSRASSDTAGFASIRRQAQAAEVSPASSAQELVARGSERPGTS
FT                   GVDDHRSTGSDRNQRLDPDDEPLGHHFRSTSPPSPVIQPPAFTHAPGEMPAMRPQPSPD
FT                   LRKANNRMSDATLTQLLAASGSMNLLGASFPSGSHETIRESNQPSPLTPNTGSDQQGAP
FT                   SLLSDTSEKRVTLQEQGPPTPEDRSSDFGPPLTLPKRSSLRLDTTKAVKRKPLPAQQIR
FT                   ESDAASVAGEPSYDDLRHTVDEEVLNWVGSRQFSLTSPDIESHQDEESIYDDASANSPD
FT                   YASTRGSVYSKRSVRSVTRPRMGVMKTVGSGPPRQDLVIGDAHYTVDEPKLELSAEIPS
FT                   IDFGPTLTYLPTTGRPNTGDTLKKSMHQRSDSNATEKQFSYQAERQHSRSPSSNVMWQP
FT                   GMTAPRPTTPGRLTAEQFVQQRSAPSPPIATHNRTLSSTPPPPRPVSGDWTNNSRPQSH
FT                   LSGSRDAPPRPRSRGANSIMNYNELSSHLSAREQEHVARMTGAPLLDISNVNKAQPTPV
FT                   NPMGLVGAIDAREREKKTIREGLSNQMVQHAIVQRQQNWQQQQMASNASAAAYNQGSHY
FT                   SLYNMPTANRTWDALNQPYRPDEPRRQSWYGQFASQQAQTPPIYQQNPPYGQHPGYSGN
FT                   ASTLHY"
     atgggtcgct cgcgtgtgct ttctctcatg tcggtcttcg ggggatcgtc ccgtaaagac        60
     aacctcagcc agcatcaccg gacatcctcg gcctctctca cactgaacaa tcctccgcga       120
     agagtagaca cgccttcttc ggataccccc tcgcctctcg atgcttcgcc gataaccggg       180
     actccacatg tcgaacgacg ggtaacatcg cggccggagt cgacgctgtt ctctcacaat       240
     cctccgttgc tggagttttc gcaggatacc cctccggagc tccaaccaat cttcggatat       300
     ctgaacagcc atgccaacaa gctataccat gaaggctatt tcctcaagtt gaacgatttg       360
     gacattcatg gtcgtccctg tgctgatcgc cagtgggttg aatgctatgc gcagcttgtc       420
     ggaaccgctc tttctttatg ggatgccgca gcgctggacg ccgcagaaga gtcggaagac       480
     gtctgcccta ctttcattaa cttagctgat gcttcaataa agatgcttga aacactacca       540
     acgagaaacc aaggagcaca gtctctgaag aacatcttga gtatatgttc cgctggccaa       600
     aacagatacc ttctgcactt taattctttc cactctctga cccagtggac cgcagccata       660
     cgactggcct tgttcgaaca tacatcctta tatgaggcat atacgggttc gatcattgcg       720
     ggcaaaggta aaggtctcaa cagtattaga accatcttgg atcgccaccg ttacaaacac       780
     gaggattggg cccgcgtgag gtttggggca ggcacgccct ggagacggtg ctggtttgtg       840
     attactcccc cgaacgagaa ggaattccag aaagcgcaga aatcaataaa gaagaagtcg       900
     gcatacgatc gagcgccccg actcataact ggcgacatca aattctatga tacgaagaag       960
     actaagaaag cgaagcctat tgcgaccatc actgatgctt acgccgctta cgccatctat      1020
     cctcagtcga gggcgttgat cgaacagtcg accttggtca agattgaagg aaagattacg      1080
     gtccacggac aaacagagtc gacaacagac gggtttgtct ttgtcatgcc cgaagtccat      1140
     cctgcggttt ctgggtttga aatgatgctc cggtttctcg tccctacttt tgacacgttc      1200
     aacctttatg ggcggcccac ccgccttatt gccgccacca accatatcaa gagcattatg      1260
     tttgccttcc ccaatcaaag gcgctatggc tatcttgata ttttagacat ctctagtcta      1320
     atgcagacac caggaagtca ggattggaac gaggcggaat ggagacagca actcaaggag      1380
     gctacagcgc gtcgcatggc ggctgctgga agcaggacga gcagtatctc tgcgagtaag      1440
     ccacgcttca gggctacaat gccgaacaga caacccaacg gccgcaccat gacgcatcaa      1500
     cgcaactgca cttccccagt taaccagctg gattccaacc agtccaacga cgctgtcgcg      1560
     cctggtgccc cccgtgatgc ttccatctct ccaattcatc atagcagggc ctcttcggac      1620
     actgccggat ttgcttccat caggagacaa gcgcaagccg ccgaagtgtc cccagcatcc      1680
     tccgctcagg aacttgtggc acgtggcagc gaacgccctg gtactagcgg ggtagacgat      1740
     catagaagca ccgggagcga caggaaccag cgacttgacc ccgacgatga gccgcttgga      1800
     catcacttcc gttcaacctc tcctccatct cccgtaatcc agccgccagc cttcacacac      1860
     gcaccgggag aaatgcccgc aatgcgacct cagccttcac cggatttgag aaaagcaaat      1920
     aataggatgt ctgacgctac cctgacacag cttctcgctg cctctggaag catgaatcta      1980
     cttggcgctt ctttcccttc aggcagccat gaaacgatca gggaatccaa ccagcctagt      2040
     ccgctaacac ctaacactgg ctctgatcaa cagggtgcgc catcgctctt atcagataca      2100
     agcgagaaga gagttaccct tcaggaacaa ggcccaccaa cccctgagga tcgttcgagt      2160
     gacttcggcc caccgctcac tttgccgaag agatcgagtc ttcgtttgga tacaaccaag      2220
     gccgtgaaac ggaagcctct gcctgcgcaa cagatccgag aatccgatgc cgcaagtgtt      2280
     gcaggggagc ctagctacga tgacctacgt catactgttg atgaagaggt cctgaattgg      2340
     gtcggctctc gccaattttc gctcacttcg cctgatatag agagccatca ggatgaggaa      2400
     agcatctatg atgacgcgtc tgcaaattct ccagattatg ccagtactcg ggggtctgtc      2460
     tacagcaagc gctcggttag gtcagtcact aggcccagaa tgggagtcat gaaaaccgtg      2520
     ggatcgggtc ccccgagaca agacttggtc atcggcgatg cgcattacac cgttgatgaa      2580
     ccaaaactgg aactcagtgc cgaaatcccc agcatcgact tcgggccgac cttaacttat      2640
     ctacctacaa ctggacgtcc caatacgggc gatactttga agaaatccat gcaccaaagg      2700
     agcgactcaa atgcaacaga aaagcagttc tcttaccagg cagagcgaca gcactcaaga      2760
     tctccaagta gcaacgtgat gtggcagccg ggtatgactg caccccgtcc caccactcca      2820
     ggcaggctta cagcggagca attcgtgcaa caacgatcag ccccaagtcc cccaatcgcc      2880
     acgcataacc gaaccctttc ctctacaccg ccgccccctc ggcctgtttc cggggactgg      2940
     acgaataact ctcggcctca gtcacacttg tctggcagcc gagatgcacc gcctcgccca      3000
     cgttcccgcg gcgccaacag catcatgaac tataatgaac tgtcgtcaca cctctcagct      3060
     cgtgaacagg aacatgtggc tcgtatgacc ggtgcacctc tactcgacat atccaacgtc      3120
     aacaaagccc agccgactcc ggtaaaccct atgggtctgg tgggagcgat tgatgctcgt      3180
     gagcgcgaga aaaagaccat ccgagaaggc ctgtccaacc aaatggtaca gcatgcaatt      3240
     gtgcaacgcc agcaaaattg gcaacaacag cagatggctt ccaatgcttc cgcagctgcc      3300
     tacaatcagg gcagccatta tagtctctac aatatgccca ctgcgaaccg cacgtgggat      3360
     gccctcaacc agccttaccg gccagacgag ccccgacgcc agtcttggta cggacagttc      3420
     gcatcacagc aggcgcagac tcctccaatc taccagcaaa acccgcctta tggccaacat      3480
     cccggctact ctggcaatgc cagcaccctg cattactga                             3519
//

If you have problems or comments...

PBIL Back to PBIL home page