(data stored in ACNUC7421 zone)

EMBL: AM269962.PE13

AM269962.PE13        Location/Qualifiers
FT   CDS_pept        join(30024..30096,30180..30337,30420..30536)
FT                   /locus_tag="An01g04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H2"
FT                   /protein_id="CAK36969.1"
FT                   /translation="MAEKAEGNESESEGKERQGERYRATQADERWRTINLLTQSKTWVL
FT                   NVVSVTSVTGLIVGSAACFLLSSFETEGEWIWSRREREDIPFERAGQMVKTKPQNNSIR
FT                   HAGWTCGSILG"
     atggcggaga aagcggaggg gaatgagtcg gaaagcgaag gaaaggagag gcagggggag        60
     agatatagag cgacacaagc cgacgagcgt tggaggacga tcaacttact tacccagtct       120
     aagacgtggg tcttgaatgt tgtgagtgta acaagtgtta ccggacttat agtagggtcg       180
     gctgcttgtt ttcttctttc ctcctttgag actgaaggag agtggatctg gtcacggcgt       240
     gagagggaag acattccctt tgaaagagcc ggtcagatgg tgaagacgaa gccgcagaat       300
     aactccatcc gtcatgctgg atggacctgc gggtcaatac ttgggtaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page