(data stored in ACNUC7421 zone)

EMBL: AM269962.PE14

AM269962.PE14        Location/Qualifiers
FT   CDS_pept        complement(join(31082..31139,31460..31684,31767..31874,
FT                   31973..32083,32264..32419,32506..32546,32641..32754,
FT                   32935..33000,33086..33238))
FT                   /locus_tag="An01g04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H3"
FT                   /protein_id="CAK36970.1"
FT                   /translation="MAMSQFRLSIFGVPTVTPVHRTLQDVCEGTGTGSPPPEWGSYCMP
FT                   STRNILGKPITELVHKPKLNCSRLHRVGARRESRRTTLVKIDCIMTTARLILQSCPNDT
FT                   LQGNEDQEKLFPRWVPTAEVILEQTKRGNTLAGGSRAGVCTTECVHPVEHLRVEVRASR
FT                   KGYDLITRGADQPQANAAATLGEAKIADGYSAMSAAEEGPLLINCFARIAGGICFRNYS
FT                   YLYRLGLSCDLEIHSNHCRQFWTFMASREASRQDHLMPCGTAGLWQCASGLLTPGPFLF
FT                   LTVALHSSVHKGQGTRRRLSLPIHPSNRTMIYPRSRTNTFALRGGINWDNPPGHPWVAR
FT                   MAD"
     atggcaatgt cgcagtttcg attatcgata tttggggttc cgacagtcac tccagtccat        60
     aggaccctgc aggatgtctg cgaaggaaca ggtacaggtt cccctccccc tgagtggggc       120
     tcgtactgta tgccctctac tagaaatata ctgggtaaac ctatcactga gcttgtccat       180
     aagccgaaac tcaattgcag cagactccac cgagtcgggg ccaggagaga aagccgtcgt       240
     accaccctag tcaagattga ttgcatcatg acaaccgcaa ggctgatcct gcaatcgtgt       300
     cccaatgata cgctccaagg gaacgaagat caagagaagc ttttcccgcg ctgggtccct       360
     acagctgagg tcattcttga gcagactaag aggggaaaca ccctggctgg tgggtcacgg       420
     gctggggttt gcactacaga gtgcgtacac cctgttgaac acctcagagt agaagtacgt       480
     gcttctagaa aaggatatga tttgatcact cgtggtgctg accagccaca agcaaatgcc       540
     gcagccactt taggcgaggc taaaattgcg gatggctact ctgcaatgtc cgcagcagag       600
     gaaggaccct tgctaattaa ttgctttgct cggatagcag ggggtatatg cttccggaac       660
     tattcttatc tttataggct tggtctgagc tgcgacttgg agatccattc caatcactgc       720
     aggcaatttt ggacatttat ggcatcccgt gaagcttccc gccaagatca tctgatgccg       780
     tgtggcacgg cgggcctgtg gcagtgcgcc agtggattat tgactcccgg accattcctc       840
     tttctgactg tcgccttgca ttcttccgtc cacaagggac aagggacacg acgacgcctt       900
     tccctcccca tccatccatc caatcgtacc atgatatacc ctcgctcgag gactaatact       960
     ttcgcattac gaggtgggat aaactgggat aatccaccag gccacccatg ggttgctcgg      1020
     atggctgact ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page