(data stored in ACNUC7421 zone)

EMBL: AM269962.PE17

AM269962.PE17        Location/Qualifiers
FT   CDS_pept        join(39790..39824,39953..40246,40319..40438,40510..40543)
FT                   /locus_tag="An01g04380"
FT                   /EC_number="2.7.7.6"
FT                   /note="Complex: S. cerevisiae Rpo26p is essential for the
FT                   assembly of RNA polymerase I and RNA polymerase II and for
FT                   the stability of the largest subunits of these enzymes."
FT                   /note="Function: the S. cerevisiae homolog RPO26 catalyses
FT                   DNA-template-directed extension of the 3'-end of an RNA
FT                   strand by one nucleotide at a time."
FT                   /note="Title: strong similarity to 23 kD subunit of
FT                   DNA-directed RNA polymerase I,II,III Rpo26 - Saccharomyces
FT                   cerevisiae"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8H6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H6"
FT                   /inference="profile:COGS:COG1758"
FT                   /inference="profile:PFAM:PF01192"
FT                   /inference="similar to AA sequence:PIR:RNBYR6"
FT                   /protein_id="CAK36973.1"
FT                   /translation="MSDYGDHDAEETYDYEPEQEYDDNEPEDFLNPEDVDVAEGGADEY
FT                   GEGSYAPAVNGNHIVASGDPNAGYAGKVMEQTREKKVPNDQRQTTPYMTKYERARVLGT
FT                   RALQISMNAPVLVDLEGETDPLQIAIKELNQKKIPLIVRRYLPDGWYEDWTCEELL"
     atgtctgact acggagacca cgacgctgag gaaacttacg actacgagcc ggagcaggag        60
     tacgatgaca acgagcccga ggacttctta aaccccgagg atgtcgacgt cgcagaagga       120
     ggagccgatg aatatggcga aggctcatac gcgcctgctg tcaacggaaa ccacattgtc       180
     gcttcaggcg acccgaatgc ggggtatgcg ggcaaggtca tggaacagac acgggagaag       240
     aaggtcccga acgaccagcg ccagacaact ccatacatga ccaagtacga gcgcgcgcgt       300
     gtcctgggta ctcgggcgct gcagatcagt atgaacgccc cggtgctcgt cgatcttgag       360
     ggcgagacgg atcctctaca gatcgccatc aaggagttga accagaagaa gatcccactg       420
     attgtgcgga gatatcttcc cgacggatgg tacgaggact ggacttgcga agaattactc       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page