(data stored in ACNUC7421 zone)

EMBL: AM269962.PE2

AM269962.PE2         Location/Qualifiers
FT   CDS_pept        join(3569..3648,3689..3955,4172..4308,4394..4626)
FT                   /locus_tag="An01g04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8G1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G1"
FT                   /protein_id="CAK36958.1"
FT                   /translation="MSGSHKPTPTPAKQAAVVQANGTVLTTWNLNGRTRPRLPFTFSNE
FT                   TLPTWLGSIVVLELLGTKLPFPSDKHGSPTRQLTCCLLIYNPIVCLARLTQPQMERDIL
FT                   SLTGHVDGGFRPCELRRFPRIAPSILSLRDAAVEGNHWKINLMWFDACRRSIDIERFAG
FT                   SSSAIVALSLGCAEIPLQLVYYTPAAAASPCYGQFHRTMSPTIHIPTFVCRYLHFLADL
FT                   SAQGQIRQNAAANPTS"
     atgtctggaa gtcacaaacc tactcctacg cctgctaagc aagcggcagt agtacaagcg        60
     aacgggacag tcttgactac atggaatttg aatggacgga caagaccaag attgcctttc       120
     actttttcca acgagacttt gccgacctgg cttggcagca tcgtggtctt ggaattgctg       180
     ggaaccaaac ttcctttccc atcagataaa catggaagcc cgacaagaca gcttacctgc       240
     tgcttgctga tctacaatcc catagtctgt ctcgcacggc tcacccaacc ccaaatggaa       300
     agagatattc tgtctctaac aggtcatgtt gacggcggct tcaggccctg cgagctaagg       360
     aggttcccca gaattgcgcc atcgatctta tcactacgtg atgcggctgt cgagggaaac       420
     cattggaaga ttaatttgat gtggtttgat gcatgccgac ggagtataga catcgaacga       480
     ttcgcgggat cctcttccgc aatagttgcc ttgtcccttg gctgcgcgga gatacctctc       540
     caactagtct actacacccc tgcagctgcg gcatctccgt gctatggaca attccatcga       600
     acgatgagcc caaccattca cattcctacc ttcgtgtgcc gatacctcca tttcctcgca       660
     gacctatcag cgcaaggaca aatcagacag aacgccgctg caaatcctac ctcctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page