(data stored in ACNUC7421 zone)

EMBL: AM269962.PE21

AM269962.PE21        Location/Qualifiers
FT   CDS_pept        join(46281..47002,47092..47665)
FT                   /locus_tag="An01g04420"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAE76116.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8I0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I0"
FT                   /protein_id="CAK36977.1"
FT                   /translation="MPSIPPPLTISHRHTRSRSSNIDIDPISPGTYAPNGFSYRSPRSP
FT                   HTPRSSIPSSPVDVRPHHTQSFNGSHRMSGDFGGAGNEGGGLGNLADELADAWEEEEGG
FT                   YGYTSGQDTGAPDAQYVDRSDDEDAYHRMGTGARTPSSGYSSERNSSLQPPRPKTRNGA
FT                   HRHRRHESQYDGSDYGNDSDFEEADMPPSLEMQMAEIESLARRGLENNGSENDFVIQRA
FT                   VEALRDLGGQSGIENNAMRLITAHSSITSHLTHQTRALQTLTHPLLFSPFPLLSSDAID
FT                   ALIPLIDEELLPNLPYPFPEQPRHSSRPTTPSQSPALNPLVSLQTLVSQTSDITLSLRG
FT                   LSDTLYESRQLTSTASRRLRSARELVADLRREEEGVEEGTRWIERGDWDRRLRDREAGR
FT                   VCGDVVSGFEAVCGEWREKLFGAAAGAEVAAA"
     atgccgtcca tcccacctcc cctgactata tctcaccgcc atactcggag tcgctcctcc        60
     aacatcgaca tcgaccccat ttctcctggc acctacgctc ccaacggctt ctcctaccgg       120
     tcgcctcggt cgcctcatac gcctcgttca tccatcccct cttctccggt ggatgtccgc       180
     cctcaccaca ctcaatcatt caatggctcc catagaatgt cgggcgactt cggcggtgca       240
     ggaaacgaag gcggcggact aggaaacttg gcagatgagc ttgcagatgc atgggaggag       300
     gaggaaggtg gttacggata cacgtcgggc caggatactg gggcccctga cgcacagtac       360
     gtggaccgca gtgacgatga agatgcatac caccgcatgg gcaccggggc ccgcacaccc       420
     tcatcgggct actcgtcgga acggaattct tccctgcagc ctccgaggcc caaaacccgt       480
     aatggtgccc atcggcaccg gcgacacgag tcgcaatatg atggctccga ttatgggaat       540
     gactcggatt tcgaggaagc ggatatgccg cctagcctag agatgcagat ggcggagatt       600
     gagagtctgg ctcgtcgcgg attagagaac aatggcagcg agaatgactt cgttattcaa       660
     cgggcggtgg aagctctccg ggatcttggc gggcagagtg ggattgaaaa taacgccatg       720
     agactcatca ccgcacactc atccatcacc tcacatctta cccatcagac ccgggcactt       780
     cagaccctca cccaccctct ccttttctcg ccatttccgc tcctttcctc agacgctata       840
     gatgcgctca ttcctctcat cgacgaagaa ctcctgccta acctccccta tcctttcccg       900
     gaacagccac gtcactcctc gagacccact accccctccc agtcaccggc cctgaaccct       960
     cttgtctcgc tgcagaccct tgtgtcgcag acatccgaca tcaccctgtc gctccgaggc      1020
     ctgagcgata cgttgtatga gtcgcggcag ctaacgtcca ctgcatcacg acgactccgg      1080
     tctgctcgcg aactcgtagc cgacctccgc cgcgaggaag aaggtgttga agaggggact      1140
     cggtggatcg aacgaggcga ctgggaccgc cgacttcggg atcgcgaagc cggccgagtc      1200
     tgcggagacg tagtcagtgg cttcgaggcg gtgtgcggtg aatggcgtga gaagctcttt      1260
     ggagcagctg ctggagccga agtggctgct gcttga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page