(data stored in ACNUC7421 zone)

EMBL: AM269962.PE22

AM269962.PE22        Location/Qualifiers
FT   CDS_pept        complement(join(49185..49701,49776..52150,52233..52457,
FT                   52588..52629))
FT                   /locus_tag="An01g04430"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor eIF-3 - Schizosaccharomyces pombe"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2Q8I1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027512"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8I1"
FT                   /inference="profile:COGS:COG0542"
FT                   /inference="similar to AA sequence:PIR:T39716"
FT                   /protein_id="CAK36978.1"
FT                   /translation="MPPPPHIKPENVLKRAQELIAVGQAPAALNVLHEHVTSKRTRSSP
FT                   IASLEPVMLLFVELCVDLRKGKAAKDGLYQYKNIAQNTNVGTIEVVLKKFIELAEKKVT
FT                   EAQAKADEIQSSLESAAPSSNVDDLEAIETPETILLATVSGEQSRDRTDRAVVTPWLKF
FT                   LWETYRTVLEILKNNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAKY
FT                   SAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSKRPAKNV
FT                   MMANYYEKLARIFLVSENYLFHAAAFSRYYNLLRQSAAALAAGQGTKKENPSVTEADMT
FT                   KAASFVLLSALSIPVISTSRSRGALVDVDEVRKNKNTRLTNLLGMASPPTRAVLFKDAL
FT                   NKGLLKRARPEIRDLYNILEVDFHPLSICKKITPILKQIGADPEMEKYVLPLQQVILTR
FT                   LFQQLSQVYESVELKFVYELAQFPDPFQITPSMIEKFIMNGCKKGDLAIRVDHISGVLT
FT                   FDTDVFSSAKALHPGSAAGSAESEVGSVQRLQNTPAEIARLQLTRLAKTLHVTCMYVDP
FT                   SYNEARLQAKRAALARAEAGAAKEHEETLARRVIIEKKKEAATDALQRKQREEETRKRI
FT                   RTQQLQEAEKQRLLDEHREREKKRIKDEQDRIRQQELKKQLEELKTGVKGIDISELDLN
FT                   ELDANRLRAMKLAQLEKEKNELNDRIRTTAKRIDHLERAFRREELKHVPEDYEKQKQRD
FT                   MEIYEATKAEALKEAEDKHKEAVALKHRLSRLVPQFNSFRKEVSEKRHEEFEKRRKAAE
FT                   RDFEAKKMQRIKEVQERRRRERAEREEEERRRKEEEERIRREEEERTAKEEERRRVLAE
FT                   EKAKREEERKRLDELAAKQKQREEEAEARRAARRTGGAEPEAAPERAAPTERTAPRLNL
FT                   APRTGGAGPSWRERQAAKEAAGGTPAAPAAAAPEPAREEPAPVRRTGGYVPPHLRSGAS
FT                   ATPAAPAPAPSTERYVPRAMREAGSSQPPSRTQTPGSSSDKPEESKPAAGKWVPRWKQQ
FT                   QGGQ"
     atgccgcctc cgcctcacat caagcctgaa aatgtcctca agagggctca ggaactcatc        60
     gccgtgggcc aggcccccgc cgccctcaac gtccttcacg aacatgtcac ctccaagcgg       120
     acgcgcagca gccccatcgc ctctctggag ccggtgatgc tcctcttcgt tgagctgtgt       180
     gttgatcttc gcaagggcaa ggccgccaag gatggtctct accagtacaa gaacatcgcc       240
     cagaacacca acgtcggaac gatcgaggtt gttctcaaga agttcatcga actcgccgag       300
     aagaaggtca ccgaggccca ggccaaggcc gatgagattc agtcttctct cgagtccgct       360
     gccccttcgt ccaacgtgga cgatctggaa gccatcgaga cccccgagac catcctgctc       420
     gccaccgtct ccggtgagca gtcccgcgac cgcactgacc gtgctgttgt caccccttgg       480
     ctcaagttcc tctgggagac ctaccgcacc gtgctcgaaa tcctcaagaa caatgcccgt       540
     cttgaggtta tgtaccagac caccgccctg caggccttcc agttctgtct caagtacacc       600
     cgcaagaccg agttccgccg tctgtgcgag ctgctccgca accacgtcca gaatgccgcc       660
     aagtactccg ctcagatgca cgccatcaac ctcagcgacc cggacactct ccagcgccac       720
     ctggacaccc gtttccagca gctgaacgtt gccgtcgagc tggagctgtg gcaggaggcc       780
     ttccgcagca ttgaggatat ccacaccctc ctcagcctca gcaagcgtcc cgccaagaac       840
     gtcatgatgg ccaactacta cgagaagctg gcccgtatct tcctggttag cgagaattac       900
     ctcttccacg ccgcggcctt cagccgttac tacaacctcc tccgccagtc cgctgccgct       960
     ttggctgctg gccagggcac caagaaggag aacccctccg tcaccgaggc cgacatgacc      1020
     aaggccgcct ccttcgtcct gctgtccgcc ctgtccatcc ccgtcatcag cacttcccgc      1080
     tcccgcggtg ccctggtcga tgtggatgag gtccgcaaga acaagaacac ccgtctcacc      1140
     aacctgttgg gtatggcctc tccccccact cgtgctgtgc tgttcaagga tgccctgaac      1200
     aagggtctgc tcaagcgcgc ccgccccgag atccgtgacc tctacaacat cctggaggtg      1260
     gacttccacc ccctgtccat ctgcaagaag atcaccccca tcctcaagca gatcggtgcc      1320
     gaccccgaga tggagaagta cgtcctgcct ctgcagcagg tcatcctgac ccgtctcttc      1380
     cagcagctgt ctcaggtcta tgagtcggtc gagctcaaat tcgtctacga gctggctcag      1440
     ttccccgacc ccttccagat caccccctcc atgatcgaga agttcatcat gaacggctgc      1500
     aagaagggcg atctcgccat ccgcgtcgac cacatctccg gtgtcctcac cttcgacacc      1560
     gacgtcttct cctcggccaa ggctctgcac cccggcagcg ccgctggctc cgccgagagc      1620
     gaggttggct ccgtccagcg cctgcagaac acccccgctg agattgcccg cctgcagctc      1680
     acccgcctgg ccaagaccct gcatgtgacc tgcatgtacg tcgacccctc gtacaacgag      1740
     gcccgcctgc aggccaagcg tgccgccctc gctcgcgccg aggctggtgc cgccaaggag      1800
     cacgaggaga ctctggctcg ccgcgtcatc atcgagaaga agaaggaggc tgccaccgat      1860
     gctctgcagc gcaagcagcg cgaggaggag actcgcaagc gcatccgcac ccagcagctt      1920
     caggaagccg agaagcagcg tctgttggat gagcaccgcg agcgtgagaa gaagcgcatc      1980
     aaggatgagc aggaccgcat ccgccagcag gagctgaaga agcagctgga ggagctcaag      2040
     actggcgtca agggcattga catcagcgag cttgacctga acgagctgga tgccaaccgc      2100
     ctccgtgcca tgaagctggc tcagctggag aaggagaaga acgagctcaa cgaccgcatc      2160
     cgcaccaccg ccaagcgcat tgaccacctg gagcgtgcct tccgtcgtga ggaactgaag      2220
     cacgtccccg aggactatga gaagcagaag cagcgcgaca tggagatcta cgaggccacc      2280
     aaggccgagg ccctcaagga ggccgaggac aagcacaagg aggccgttgc cctcaagcac      2340
     cgtctcagcc gcctggtgcc tcaattcaac agcttccgca aggaggtgtc ggagaagcgc      2400
     cacgaggagt tcgagaagcg ccgcaaggct gctgagcgtg acttcgaggc caagaagatg      2460
     cagcgtatca aggaggtcca ggagcgcaga cgccgtgagc gggccgagcg tgaggaggaa      2520
     gagcgccgcc gcaaggaaga ggaggagcgc atccgtcgcg aggaagagga gagaaccgcc      2580
     aaggaggagg agcgccgccg cgtcctggct gaggagaagg ccaagcgtga ggaagagaga      2640
     aagagactcg atgaacttgc tgccaagcag aagcagcgtg aagaggaagc cgaagctcgc      2700
     cgtgccgctc gccggaccgg tggtgctgag cccgaggcag ctcctgagcg tgctgctcct      2760
     actgaacgca ctgctcctcg tctcaacctg gctccccgca ccggtggtgc tggtcccagc      2820
     tggagagagc gtcaggctgc caaggaggct gctggtggca ctcctgctgc tcctgctgct      2880
     gctgctcccg agcctgcccg cgaggagccc gctcctgtgc gcagaactgg tggctacgtg      2940
     cctcctcacc tgcgctcggg tgccagtgct acccctgctg cccctgctcc tgctccttcc      3000
     acggagcgct acgttccccg tgccatgcgc gaggccggct cttcccagcc cccctcccgc      3060
     acgcagaccc ccggctccag ctccgacaag cccgaggagt ccaagcctgc cgctggcaag      3120
     tgggtgccca gatggaagca gcagcagggt ggccagtaa                             3159
//

If you have problems or comments...

PBIL Back to PBIL home page