(data stored in ACNUC7421 zone)

EMBL: AM269962.PE3

AM269962.PE3         Location/Qualifiers
FT   CDS_pept        complement(join(5951..6341,6403..7071,7133..7518))
FT                   /locus_tag="An01g04230"
FT                   /note="Title: strong similarity to hypothetical WD-repeat
FT                   transcription regulation protein SPCC18.13
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8G2"
FT                   /db_xref="InterPro:IPR028884"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G2"
FT                   /inference="similar to AA sequence:PIR:T41156"
FT                   /protein_id="CAK36959.1"
FT                   /translation="MSAHFQHPLQCLRLVQRSTANLLIGSAGSKLYSYSAETGQRLAVW
FT                   PEDVASSETKPVDAESAPEQGPPEKKRKVSSSDSPTIEKPAWSNIPIVTGTASGEHIIA
FT                   LTAEDKCVRVFQLQEDGSFVQLSQRVMPKRPSAITLTDDDDTILCGDKFGDVYSLPLIP
FT                   SDKLPAITKSLRSAKLSHPAATNLTVHTKGNRRALEQQLRLASEGKRDEKSSGPTFEHK
FT                   ILLGHVSLLTDMAYVSLPVDENKKRSYILTADRDEHIRVSRGPPQAHVIENYCLGHTAF
FT                   ISKLCVPQWAPQYLVSGGGDNYLLVWKWAEGRILQKVSLVDEASESTEVAVQGIWATSL
FT                   GNLRIILVALHGSSRLQCFTLESDGSLKTQASIQLSGNVLDLTPVEKDNTILVSVDSIR
FT                   QPDSTQEWRTSPSSPSTLIEAFHIKSGTDSLEWEPTAASVTDKINSTGTEEVPATTEEK
FT                   QRKELNDSLYGLGHLRKRKGEDE"
     atgtctgcgc actttcaaca tcccttgcaa tgcctccgct tggtgcagag gtcaactgcg        60
     aacctgctga tagggtcagc gggctccaag ctctactcct actccgcaga aactggccag       120
     cggctggcgg tttggccaga agatgtcgct tcgagtgaaa ccaagcctgt tgacgcagag       180
     tccgctcccg agcagggacc cccagagaag aagcggaagg tttcttcatc agattcccca       240
     acaattgaga agcctgcttg gtcaaacatc cccatagtaa ctggcactgc gagcggagag       300
     cacataattg cgcttaccgc cgaagataag tgcgtgcgtg tattccagct tcaggaagat       360
     ggttcctttg ttcaattgag ccagagagtt atgcccaagc gaccctccgc cattaccctc       420
     actgatgacg acgacactat cctgtgtggt gacaaattcg gagacgtcta ctcattgcca       480
     ctgattccaa gtgacaagct tcctgcgatc acaaaatccc tcaggagcgc aaaactcagc       540
     cacccggcgg caacaaacct gaccgtgcac acgaagggca accgaagagc tttggaacaa       600
     caattgcgtc tagctagtga aggaaagagg gatgagaagt cctctggccc gacttttgaa       660
     cacaaaatct tgcttggcca tgtgtcgctg cttacggata tggcttatgt ctcccttccg       720
     gtggatgaaa acaaaaagcg cagctacatc ctgactgcgg accgagatga acatatccgt       780
     gtctcccgtg gtcctcccca ggcccacgtc attgaaaact actgcttggg ccacacagca       840
     ttcatcagca agctttgcgt gccccagtgg gcaccccagt atctcgtatc cggtggaggt       900
     gacaactacc tgctcgtttg gaaatgggct gaaggccgaa tcctccagaa ggtttctttg       960
     gtagacgagg catcagaatc tacggaggtt gcagtgcaag gtatctgggc gacatcgctg      1020
     gggaacttgc gtatcatcct cgtcgcgctt cacggatcct cccgtctgca atgcttcacg      1080
     ctggaatctg acggcagctt gaaaacgcaa gcctccatcc aactttccgg caacgtcctc      1140
     gatcttaccc ccgtcgagaa agacaacact atccttgtct ccgtcgactc tatccgccag      1200
     ccggactcaa ctcaagaatg gagaaccagc ccctcctccc cctccaccct aattgaagca      1260
     ttccacatca agtcaggcac tgatagcttg gaatgggagc cgaccgcggc atccgtgacc      1320
     gacaagatca actccaccgg cacggaagaa gttccagcaa ccacagagga gaagcaacgc      1380
     aaggaactga acgactcgct atatggattg gggcatcttc ggaagaggaa gggtgaagat      1440
     gagtga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page