(data stored in ACNUC7421 zone)

EMBL: AM269962.PE4

AM269962.PE4         Location/Qualifiers
FT   CDS_pept        join(7854..8027,8085..8154,8219..8913)
FT                   /locus_tag="An01g04240"
FT                   /note="Remark: P0 of S. cerevisiae belongs to the family of
FT                   rat acidic ribosomal proteins P0."
FT                   /note="Remark: P0 of S. cerevisiae is also called A0,L8300.
FT                   8, YLR340w and ribosomal protein YL10e."
FT                   /note="Similarity: the ORF overlaps with the EST seq id
FT                   NO:3822 of patent WO200056762-A2 from A. niger."
FT                   /note="Title: strong similarity to cytoplasmic acidic
FT                   ribosomal protein P0 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 2681177"
FT                   /note="See PMID 3287327"
FT                   /db_xref="GOA:A2Q8G3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR030670"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G3"
FT                   /inference="profile:COGS:COG0244"
FT                   /inference="profile:PFAM:PF00428"
FT                   /inference="profile:PFAM:PF00466"
FT                   /inference="similar to AA sequence:PIR:R5BY0E"
FT                   /protein_id="CAK36960.1"
FT                   /translation="MGGKSATKAAYFEKLKALLDEYKTVFIVGVDNVSSQQMHEIRLSL
FT                   RGEGVVLMGKNTMVRRAIKGFVNDNPEYERLLPFVKGNVGFIFTNGDLKATKEKILANR
FT                   VAAPARAGAIAPGDVWVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGS
FT                   KVGPSEATLLNMLNISPFTYGMTIQQVYDQGQCFSSAVLDIEESQLLEAFSSAINTITT
FT                   ISLAVSYPTIPAVMHSLVNSYKKVLAVAVETEYSWPEIEELKDRIANPDAYASAAPAAA
FT                   AAPAAGGAPAAEAPKEEEEESDEDMGFGLFD"
     atggggggca agtctgctac caaggccgct tacttcgaga agctcaaggc ccttctcgat        60
     gagtacaaga cggtcttcat tgtcggtgtc gacaatgtca gctctcagca gatgcacgag       120
     attcgtctga gtctccgtgg cgagggtgtc gtcctgatgg gtaagaacac catggttcgc       180
     cgtgccatca agggcttcgt caacgacaac cccgagtacg agcgtctgct ccccttcgtt       240
     aagggtaacg ttggtttcat cttcaccaac ggtgacctca aggccaccaa ggagaagatc       300
     ctggccaacc gtgtcgctgc tcccgctcgt gccggtgcca tcgctcctgg cgatgtctgg       360
     gtccccgccg gtaacaccgg tatggaaccc ggtaagacct ctttcttcca ggctcttggt       420
     gtccccacca agattgctcg tggtaccatt gaaattacca ccgacctcaa gctcgttgag       480
     gctggaagca aggtcggtcc ctccgaggcc accctgctca acatgctgaa catctctccc       540
     ttcacctatg gtatgaccat ccagcaggtc tacgaccagg gtcagtgctt cagctctgct       600
     gtcctggaca ttgaggagtc tcagctcctc gaggccttct ccagcgccat taacaccatc       660
     accaccatct ccctggctgt cagctacccc actatccccg ctgtcatgca ctccctcgtc       720
     aacagctaca agaaggttct tgccgttgct gttgagaccg agtacagctg gcccgagatt       780
     gaggagctca aggaccgtat tgccaaccct gacgcttacg cctccgctgc tcctgccgct       840
     gccgctgccc ctgctgccgg tggtgctccc gccgctgagg ctcccaagga ggaagaggag       900
     gagtccgatg aggacatggg cttcggcctc ttcgactaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page