(data stored in ACNUC7421 zone)

EMBL: AM269962.PE5

AM269962.PE5         Location/Qualifiers
FT   CDS_pept        join(9732..9786,9842..9883,9982..10905,10955..11025)
FT                   /locus_tag="An01g04250"
FT                   /EC_number="4.1.1.37"
FT                   /note="Catalytic activity: Uroporphyrinogen-III <=>
FT                   coproporphyrinogen + 4 CO(2)."
FT                   /note="Function: the T. terrestris homolog catalyzes the
FT                   sequential decarboxylation of the four acetyl side chains
FT                   of uroporphyrinogen to yield coproporphyrinogen, an
FT                   intermediate in protoheme biosynthesis."
FT                   /note="Title: strong similarity to uroporphyrinogen
FT                   decarboxylase from patent WO9925839-A1 - Thielavia
FT                   terrestris"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2Q8G4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G4"
FT                   /inference="profile:COGS:COG0407"
FT                   /inference="profile:PFAM:PF01208"
FT                   /protein_id="CAK36961.1"
FT                   /translation="MQHQFEPLKNDLLLRAARGEKVQRPPIWVMRQAGRYLPEYHEAKA
FT                   GRDFFECCRDPEVASTLTIQPIDRYAGLIDAAIIFSDILVIPQAMGMQVEMVDKKGPHF
FT                   PEPLQSPDDGQYEKVMQKDVDVKSELDYVYKAITLTRHKLQGRVPLIGFCGAPWTLLCY
FT                   MVEGGGTKLFVQSKKWIYKYPKESQALLQKIAEICVEYLALQVAAGAQLVQVFDSWAGE
FT                   LSPAAFKSFSLPYLRHISANLPKKLKEMGLEPVPMTVFAKGAWFGLEDLCESGYNVVGL
FT                   DWLHDPAEARRIANGRVTIQGNADPGVLYGGREAITEAVETMVRGFEKGKQGWIANLGH
FT                   GVTPFVNPDDLKFFFEEIHRLTV"
     atgcagcatc aattcgagcc attgaagaac gacctcttgc tgagggctgc taggggcgag        60
     aaagtccagc gtcctccgat atgggttatg cggcaagctg gccgttatct ccccgaatac       120
     catgaagcca aagccggccg cgactttttc gaatgctgcc gcgaccccga agtcgcatcg       180
     acgttgacga tccagcccat cgaccgctac gccggactca tcgatgctgc gatcatcttc       240
     tccgatattc tggtcattcc ccaggccatg ggaatgcagg ttgagatggt cgacaagaag       300
     ggaccccact tccccgagcc gctccagtcg cccgatgatg gacagtacga gaaagtgatg       360
     cagaaggatg tggatgtcaa gtcggagctc gactacgtct acaaggccat taccctcacc       420
     cgccacaagc tgcagggtcg tgtgccgttg atcggctttt gcggtgcccc gtggactctg       480
     ctgtgctaca tggtagaggg aggcggcacg aaactgttcg tccagtcgaa gaagtggatc       540
     tacaagtacc ccaaggagtc gcaggctctc ctgcagaaga tcgccgagat ctgtgttgaa       600
     tacctggcgc ttcaggttgc tgctggtgct cagctggtac aggtcttcga ttcctgggcg       660
     ggtgagctgt ctccggccgc tttcaagtca ttctctcttc cctacctgcg tcacatttcg       720
     gcgaatctgc cgaagaagtt gaaggagatg ggtctggagc ctgttccgat gacagtcttc       780
     gcgaagggtg cgtggtttgg tcttgaggat ctctgcgagt cgggctacaa tgttgttggc       840
     ttggactggc tgcacgaccc cgctgaggct aggcggattg ccaatggtcg tgtgacgatc       900
     cagggtaatg ctgaccctgg tgttctctat ggaggacgcg aggctatcac ggaggctgtg       960
     gagactatgg ttcggggatt cgagaagggc aagcaaggct ggattgccaa cttgggtcac      1020
     ggtgtgactc ctttcgtcaa cccggatgat ctcaagttct tcttcgaaga gatccaccgt      1080
     ctgacggtct aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page